StarFunc result for job id Q8NAF0

User Input

>input (562 residues)
MDPQPPPPAQGSPPHRGRGRGRGRGRGRGRGRGRGGAGAPRAPLPCPTCGRLFRFPYYLS
RHRLSHSGLRPHACPLCPKAFRRPAHLSRHLRGHGPQPPLRCAACPRTFPEPAQLRRHLA
QEHAGGEVELAIERVAKETAEPSWGPQDEGSEPPTTAAAGATEEEAVAAWPETWPAGEPS
TLAAPTSAAEPRESESEEAEAGAAELRAELALAAGRQEEKQVLLQADWTLLCLRCREAFA
TKGELKAHPCLRPEGEQEGEGGPPPRPKRHQCSICLKAFARPWSLSRHRLVHSTDRPFVC
PDCGLAFRLASYLRQHRRVHGPLSLLAPLPAAGKKDDKASGARNSAKGPEGGEGAECGGA
SEGGEGQNGGDAAPARPPAGEPRFWCPECGKGFRRRAHLRQHGVTHSGARPFQCVRCQRE
FKRLADLARHAQVHAGGPAPHPCPRCPRRFSRAYSLLRHQRCHRAELERAAALQALQAQA
PTSPPPPPPPLKAEQEEEGLPLPLANIKEEPPSPGTPPQSPPAPPVFLSASCFDSQDHSA
FEMEEEEVDSKAHLRGLGGLAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NAF0	1.000	1.000	2.158E-92	562	1.000	1.000	Q8NAF0.pdb.gz	ZN579_HUMAN Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2
2	AFDB:A0A090N8H1	0.157	0.156	1.209E-20	567	0.226	0.224	A0A090N8H1.pdb.gz	A0A090N8H1_HUMAN HCG1990708, isoform CRA_c OS=Homo sapiens OX=9606 GN=REPIN1 PE=4 SV=1
3	AFDB:Q8K2R5	0.180	0.165	4.698E-20	619	0.203	0.184	Q8K2R5.pdb.gz	ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus OX=10090 GN=Znf668 PE=2 SV=1
4	AFDB:Q96BV0	0.169	0.174	5.653E-20	537	0.224	0.235	Q96BV0.pdb.gz	ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens OX=9606 GN=ZNF775 PE=1 SV=2
5	AFDB:Q5U4E2	0.210	0.216	1.185E-19	545	0.196	0.202	Q5U4E2.pdb.gz	REPI1_MOUSE Replication initiator 1 OS=Mus musculus OX=10090 GN=Repin1 PE=1 SV=1
6	AFDB:A0A024R4T5	0.241	0.187	1.341E-19	734	0.221	0.169	A0A024R4T5.pdb.gz
7	AFDB:Q32PL2	0.166	0.190	1.941E-19	478	0.171	0.201	Q32PL2.pdb.gz
8	AFDB:P59923	0.152	0.094	1.314E-18	1031	0.205	0.112	P59923.pdb.gz	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
9	AFDB:Q68DI1	0.202	0.217	1.682E-18	518	0.167	0.181	Q68DI1.pdb.gz	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
10	AFDB:M9NFP1	0.217	0.159	2.755E-18	825	0.208	0.142	M9NFP1.pdb.gz	M9NFP1_DROME Jim, isoform E OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
11	PDB:3w5kB	0.068	0.230	1.321E-2	110	0.052	0.264	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:1b8tA	0.035	0.084	6.053E-1	192	0.048	0.141	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:6rw4O	0.052	0.107	1.838	194	0.052	0.149	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
14	PDB:6gawAp	0.052	0.114	2.211	190	0.043	0.126	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
15	PDB:7ajtCK	0.046	0.095	2.352	207	0.050	0.135	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:6htsR	0.044	0.296	2.830	72	0.021	0.167	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
17	PDB:7pntO	0.051	0.106	2.830	197	0.043	0.122	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
18	PDB:5lj5t	0.042	0.052	3.852	438	0.028	0.037	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
19	PDB:7ad8D	0.043	0.066	4.636	280	0.023	0.046	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
20	PDB:7l08r	0.034	0.087	4.636	162	0.028	0.099	7l08r.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NAF0	0.0	1088	562	1.000	1.000	ZN579_HUMAN Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2
2	P17020	4.68e-38	151	682	0.203	0.167	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
3	F1LTH0	1.86e-36	147	967	0.205	0.119	F1LTH0_RAT Zinc finger protein 473 OS=Rattus norvegicus OX=10116 GN=Zfp473 PE=4 SV=3
4	A0A8I5Y2B3	1.89e-36	147	936	0.205	0.123	A0A8I5Y2B3_RAT Zinc finger protein 473 OS=Rattus norvegicus OX=10116 GN=Zfp473 PE=4 SV=1
5	P51523	8.73e-36	144	738	0.221	0.168	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
6	Q9P2J8	1.43e-35	144	865	0.208	0.135	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
7	Q14585	8.74e-34	136	488	0.212	0.244	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
8	Q3URR7	1.23e-33	138	782	0.233	0.168	ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus OX=10090 GN=Zscan10 PE=1 SV=2
9	Q9UII5	1.75e-33	138	783	0.180	0.129	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
10	O75123	2.34e-33	135	536	0.205	0.215	ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens OX=9606 GN=ZNF623 PE=1 SV=3
11	Q8BLA2	2.40e-33	136	578	0.208	0.202	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
12	Q6ZNH5	5.22e-33	134	498	0.244	0.275	ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens OX=9606 GN=ZNF497 PE=1 SV=2
13	Q7TMN8	6.10e-33	135	578	0.208	0.202	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
14	Q05481	6.69e-33	136	1191	0.196	0.092	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
15	P35789	2.00e-32	134	620	0.199	0.181	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
16	Q8TAQ5	2.10e-32	134	688	0.208	0.170	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
17	Q4V8A8	5.03e-32	132	633	0.183	0.163	ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus OX=10116 GN=Zfp90 PE=2 SV=1
18	P15620	6.26e-32	132	580	0.205	0.198	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
19	Q49A12	8.55e-32	131	536	0.187	0.196	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
20	Q76KX8	9.67e-32	132	674	0.194	0.162	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14353 CpXC	3.1	19.3	CpXC protein
2	PF00096 zf-C2H2	7.1e-32	119.2	Zinc finger, C2H2 type
3	PF18868 zf-C2H2_3rep	19	17.4	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	3e-21	85.3	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	33	15.9	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	7.9e-08	43.6	Zinc-finger double-stranded RNA-binding
7	PF16278 zf-C2HE	0.39	22.5	C2HE / C2H2 / C2HC zinc-binding finger
8	PF13465 zf-H2C2_2	1.6e-15	68.0	Zinc-finger double domain
9	PF08790 zf-LYAR	12	17.2	LYAR-type C2HC zinc finger
10	PF12874 zf-met	1e-08	46.5	Zinc-finger of C2H2 type
11	PF18387 zf_C2H2_ZHX	6.2	17.9	Zinc-fingers and homeoboxes C2H2 finger domain
12	PF18366 zf_ZIC	0.87	21.0	Zic proteins zinc finger domain
13	PF09723 Zn-ribbon_8	1.4e+02	14.0	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320188

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338572	0.635	Zinc finger protein 212
2	9606.ENSP00000085068	0.596	Isochorismatase domain containing 2
3	9606.ENSP00000205194	0.546	N-acetyltransferase 14
4	9606.ENSP00000352956	0.537	Probable RNA-binding protein 23
5	9606.ENSP00000339883	0.505	Lamin-B receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.997	transcription regulator activity
GO:0005515	0.995	protein binding
GO:0000981	0.994	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003723	0.994	RNA binding
GO:0000976	0.992	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.871	regulation of metabolic process
GO:0031323	0.840	regulation of cellular metabolic process
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0080090	0.832	regulation of primary metabolic process
GO:0060255	0.821	regulation of macromolecule metabolic process
GO:0010468	0.713	regulation of gene expression
GO:0051252	0.700	regulation of RNA metabolic process
GO:0009889	0.685	regulation of biosynthetic process
GO:0006355	0.681	regulation of DNA-templated transcription
GO:0006357	0.414	regulation of transcription by RNA polymerase II
GO:0009987	0.413	cellular process
GO:0071704	0.302	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.975	nucleoplasm
GO:0043228	0.716	non-membrane-bounded organelle
GO:0043232	0.617	intracellular non-membrane-bounded organelle
GO:0032991	0.566	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]