StarFunc result for job id Q8NAM6

User Input

>input (433 residues)
MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQ
ELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIE
DLTDDSINPPALVHVHMQGQEALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQD
TSLETGQGYEDEQDGWNSSSKTTRVNENITNQGNQIVSLIIIQEENGPRPEEGGVSSDNP
YNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQSSPESALTHQSNEGNSTCEV
HQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISDLRVHQI
IHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK
ITLPSVPSTPEAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NAM6	1.000	1.000	5.744E-71	433	1.000	1.000	Q8NAM6.pdb.gz	ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZSCAN4 PE=1 SV=1
2	AFDB:Q86W11	0.274	0.241	2.379E-20	494	0.263	0.231	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
3	AFDB:O43309	0.264	0.192	6.418E-19	604	0.259	0.185	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
4	AFDB:P10073	0.274	0.243	4.255E-18	491	0.219	0.193	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
5	AFDB:A0A024RC47	0.285	0.332	1.629E-17	368	0.249	0.293	A0A024RC47.pdb.gz
6	AFDB:Q9BRR0	0.259	0.209	8.995E-17	538	0.259	0.208	Q9BRR0.pdb.gz	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
7	AFDB:Q96GC6	0.253	0.170	9.561E-17	653	0.261	0.173	Q96GC6.pdb.gz	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
8	AFDB:A0A024R4T5	0.252	0.152	1.148E-16	734	0.259	0.153	A0A024R4T5.pdb.gz
9	AFDB:O14978	0.261	0.170	1.988E-16	683	0.298	0.189	O14978.pdb.gz	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
10	AFDB:Q96N58	0.253	0.187	6.339E-16	590	0.206	0.151	Q96N58.pdb.gz	ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens OX=9606 GN=ZNF578 PE=1 SV=2
11	PDB:3w5kB	0.109	0.264	7.773E-4	110	0.083	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4r8pL	0.057	0.083	1.042	254	0.044	0.075	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:6ydhA	0.047	0.209	3.321	62	0.028	0.194	6ydhA.pdb.gz
14	PDB:2ja2A	0.057	0.052	5.411	485	0.039	0.035	2ja2A.pdb.gz
15	PDB:4yrvA	0.053	0.072	5.411	288	0.030	0.045	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
16	PDB:6ke6A8	0.073	0.061	5.411	548	0.053	0.042	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
17	PDB:7oniR	0.048	0.145	5.411	86	0.028	0.140	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:6f40P	0.077	0.105	5.751	246	0.037	0.065	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
19	PDB:2lgvA	0.047	0.124	6.113	100	0.035	0.150	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
20	PDB:7ajtUO	0.073	0.067	6.113	493	0.053	0.047	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NAM6	0.0	907	433	1.000	1.000	ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZSCAN4 PE=1 SV=1
2	Q80VJ6	1.06e-57	199	506	0.252	0.215	ZSC4C_MOUSE Zinc finger and SCAN domain containing protein 4C OS=Mus musculus OX=10090 GN=Zscan4c PE=2 SV=1
3	E9Q3G0	4.26e-56	195	505	0.249	0.214	E9Q3G0_MOUSE Zinc finger and SCAN domain containing 4B OS=Mus musculus OX=10090 GN=Zscan4b PE=4 SV=1
4	A6NJL1	5.17e-44	162	495	0.291	0.255	ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ZSCAN5B PE=1 SV=1
5	O60304	4.31e-38	145	480	0.293	0.265	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
6	O43309	6.49e-35	139	611	0.256	0.182	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
7	A0A0S2Z658	9.25e-35	137	545	0.261	0.207	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
8	Q969J2	9.25e-35	137	545	0.261	0.207	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
9	Q15697	2.66e-34	134	407	0.259	0.275	ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens OX=9606 GN=ZNF174 PE=1 SV=1
10	Q91VN1	4.67e-34	132	368	0.259	0.304	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
11	Q8NF99	8.31e-34	134	534	0.263	0.213	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
12	P17028	1.25e-32	129	368	0.249	0.293	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
13	Q86W11	2.81e-32	130	494	0.254	0.223	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
14	Q3MJ62	2.97e-32	128	389	0.256	0.285	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
15	Q15776	6.09e-32	130	578	0.279	0.209	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
16	Q9UNY5	7.94e-32	127	417	0.254	0.264	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
17	I3L4J6	1.19e-31	127	435	0.254	0.253	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
18	Q9H707	2.65e-30	123	407	0.136	0.145	ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens OX=9606 GN=ZNF552 PE=1 SV=2
19	Q5EBL2	3.33e-30	125	1059	0.143	0.059	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
20	Q9UJW7	4.63e-30	125	825	0.143	0.075	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	95	14.7	TFIIH C1-like domain
2	PF09538 FYDLN_acid	4.1e+02	13.0	Protein of unknown function (FYDLN_acid)
3	PF09237 GAGA	0.0047	28.2	GAGA factor
4	PF00628 PHD	5.7e+02	11.8	PHD-finger
5	PF02023 SCAN	1.1e-18	78.2	SCAN domain
6	PF16700 SNCAIP_SNCA_bd	1.6e+02	13.4	Synphilin-1 alpha-Synuclein-binding domain
7	PF12596 Tnp_P_element_C	2.6e+02	13.5	87kDa Transposase
8	PF00096 zf-C2H2	3.9e-15	66.5	Zinc finger, C2H2 type
9	PF13894 zf-C2H2_4	6.8e-09	46.8	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	0.44	22.1	Zinc-finger double-stranded RNA-binding
11	PF05605 zf-Di19	36	16.1	Drought induced 19 protein (Di19), zinc-binding
12	PF13465 zf-H2C2_2	4e-21	85.6	Zinc-finger double domain
13	PF12874 zf-met	8.8	18.1	Zinc-finger of C2H2 type
14	PF09723 Zn-ribbon_8	2.1e+02	13.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321963

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370800	0.730	methyl-CpG binding domain protein 3 like 2
2	9606.ENSP00000458065	0.713	Double homeobox protein 4
3	9606.ENSP00000451411	0.711	Double homeobox 4 like 7
4	9606.ENSP00000485452	0.710	Double homeodomain protein DUX4-s
5	9606.ENSP00000451207	0.698	Double homeobox 4 like 1
6	9606.ENSP00000272395	0.693	Tripartite motif containing 43
7	9606.ENSP00000383042	0.658	Lysine-specific histone demethylase 1A
8	9606.ENSP00000300433	0.651	Transmembrane protein 92
9	9606.ENSP00000380053	0.633	PRD class homeoboxes and pseudogenes
10	9606.ENSP00000332134	0.622	PRAME family member 1
11	9606.ENSP00000240189	0.618	PRAME family member 2
12	9606.ENSP00000485108	0.610	Upstream-binding factor 1-like protein 1
13	9606.ENSP00000423391	0.596	Ret finger protein like 4B
14	9606.ENSP00000229307	0.575	Homeobox protein NANOG
15	9606.ENSP00000259915	0.570	POU domain, class 5, transcription factor 1
16	9606.ENSP00000452398	0.568	Double homeobox protein A
17	9606.ENSP00000326603	0.558	Structural maintenance of chromosomes flexible hinge domain-containing protein 1
18	9606.ENSP00000359415	0.556	Putative KHDC1-like protein
19	9606.ENSP00000365322	0.536	PRAME family member 9
20	9606.ENSP00000383096	0.534	Ret finger protein-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.720	transcription regulator activity
GO:0003700	0.627	DNA-binding transcription factor activity
GO:0000976	0.460	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0048519	0.984	negative regulation of biological process
GO:0010468	0.977	regulation of gene expression
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0051171	0.946	regulation of nitrogen compound metabolic process
GO:0048523	0.945	negative regulation of cellular process
GO:0019219	0.932	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.919	cellular process
GO:0045934	0.911	negative regulation of nucleobase-containing compound metabolic process
GO:0051252	0.899	regulation of RNA metabolic process
GO:0010605	0.893	negative regulation of macromolecule metabolic process
GO:2001141	0.888	regulation of RNA biosynthetic process
GO:0006355	0.878	regulation of DNA-templated transcription
GO:0048518	0.573	positive regulation of biological process
GO:0010558	0.513	negative regulation of macromolecule biosynthetic process
GO:0031327	0.507	negative regulation of cellular biosynthetic process
GO:0071704	0.497	organic substance metabolic process
GO:1902679	0.496	negative regulation of RNA biosynthetic process
GO:0044238	0.491	primary metabolic process
GO:1903507	0.481	negative regulation of nucleic acid-templated transcription
GO:0045892	0.473	negative regulation of DNA-templated transcription
GO:0006807	0.462	nitrogen compound metabolic process
GO:0006357	0.461	regulation of transcription by RNA polymerase II
GO:0044237	0.452	cellular metabolic process
GO:0048522	0.451	positive regulation of cellular process
GO:0032502	0.416	developmental process
GO:0043170	0.407	macromolecule metabolic process
GO:0009893	0.405	positive regulation of metabolic process
GO:0010604	0.391	positive regulation of macromolecule metabolic process
GO:0071840	0.387	cellular component organization or biogenesis
GO:0032501	0.362	multicellular organismal process
GO:0031325	0.348	positive regulation of cellular metabolic process
GO:0051173	0.345	positive regulation of nitrogen compound metabolic process
GO:0000122	0.333	negative regulation of transcription by RNA polymerase II
GO:0016043	0.320	cellular component organization
GO:0045935	0.308	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0005654	0.981	nucleoplasm
GO:0005694	0.897	chromosome
GO:0005737	0.379	cytoplasm
GO:0098687	0.374	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]