StarFunc result for job id Q8NAP3

User Input

>input (1195 residues)
MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKN
IFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFLE
DLTDRNFSNSPGPYVFCITEKGVVKEEKNEKRHEEPAITNGPRITNAFSIIETENSNNMF
SPLDLRASFKKVSDSMRTASLCLERTDVCHEAEPVRTLAEHSYAVSSVAEAYRSQPVREH
DGSSPGNTGKENCEALAAKPKTCRKPKTFSIPQDSDSATENIPPPPVSNLEVNQERSPQP
AAVLTRSKSPNNEGDVHFSREDENQSSDVPGPPAAEVPPLVYNCSCCSKAFDSSTLLSAH
MQLHKPTQEPLVCKYCNKQFTTLNRLDRHEQICMRSSHMPIPGGNQRFLENYPTIGQNGG
SFTGPEPLLSENRIGEFSSTGSTLPDTDHMVKFVNGQMLYSCVVCKRSYVTLSSLRRHAN
VHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHA
IDHRLSISKKTANGGLKPSVYPYKLYRLLPMKCKRAPYKSYRNSSYENARENSQMNESAP
GTYVVQNPHSSELPTLNFQDTVNTLTNSPAIPLETSACQDIPTSANVQNAEGTKWGEEAL
KMDLDNNFYSTEVSVSSTENAVSSDLRAGDVPVLSLSNSSENAASVISYSGSAPSVIVHS
SQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASRPKSIKEKKKT
TSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKIETYIAKPALPGTSTNSNVAPLCQIT
VKIGNEAIVKRHILGSKLFYKRGRRPKYQMQEEPLPQGNDPEPSGDSPLGLCQSECMEMS
EVFDDASDQDSTDKPWRPYYNYKPKKKSRQLKKMRKVNWRKEHGNRSPSHKCKYPAELDC
AVGKAPQDKPFEEEETKEMPKLQCELCDGDKAVGAGNQGRPHRHLTSRPYACELCAKQFQ
SPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGLKEFVCQYCNKAFTLNET
LKIHERIHTGEKRYHCQFCFQRFLYLSTKRNHEQRHIREHNGKGYACFQCPKICKTAAAL
GMHQKKHLFKSPSQQEKIGDVCHENSNPLENQHFIGSEDNDQKDNIQTGVENVVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5EXX3	0.217	0.216	0.000	1203	0.807	0.801	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
2	AFDB:Q8NAP3	1.000	1.000	0.000	1195	1.000	1.000	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
3	AFDB:M9NEG1	0.079	0.083	1.907E-12	1109	0.149	0.161	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
4	AFDB:A2A935	0.069	0.065	4.362E-9	1275	0.139	0.130	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
5	AFDB:A2A7B5	0.062	0.047	5.901E-9	1709	0.165	0.115	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
6	AFDB:Q13029	0.067	0.053	6.268E-9	1718	0.162	0.113	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
7	AFDB:A0A5K4F1D0	0.091	0.046	1.010E-7	2566	0.145	0.067	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
8	AFDB:Q62255	0.067	0.063	1.073E-7	1320	0.155	0.140	Q62255.pdb.gz	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
9	AFDB:Q2EI20	0.056	0.071	1.542E-7	855	0.113	0.158	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
10	AFDB:Q9VXJ5	0.054	0.051	2.822E-7	1311	0.114	0.104	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
11	PDB:3w5kB	0.048	0.275	1.345E-4	110	0.033	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5iwcA	0.042	0.097	1.394	297	0.009	0.037	5iwcA.pdb.gz	Inhibitors of the Cysteine Synthase CysM with Antibacterial Potency against Dormant Mycobacterium tuberculosis.
13	PDB:1jr3D	0.032	0.080	1.573	338	0.016	0.056	1jr3D.pdb.gz	Crystal structure of the processivity clamp loader gamma (gamma) complex of E. coli DNA polymerase III.
14	PDB:3gn5A	0.020	0.109	1.775	132	0.008	0.068	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
15	PDB:2k8pA	0.028	0.128	2.550	189	0.020	0.127	2k8pA.pdb.gz
16	PDB:4v6iBh	0.034	0.224	2.709	130	0.015	0.138	4v6iBh.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
17	PDB:5sy1A	0.028	0.039	3.057	582	0.018	0.036	5sy1A.pdb.gz	Structure of the STRA6 receptor for retinol uptake.
18	PDB:5zwmv	0.024	0.127	3.057	174	0.008	0.052	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
19	PDB:2jo6A	0.017	0.184	3.248	110	0.002	0.018	2jo6A.pdb.gz
20	PDB:6f40W	0.034	0.106	3.248	218	0.015	0.083	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV48	0.0	1509	725	0.607	1.000	A0A1B0GV48_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
2	D6RBC4	0.0	1602	771	0.645	1.000	D6RBC4_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
3	Q5EXX3	0.0	1984	1203	0.808	0.802	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
4	Q8NAP3	0.0	2506	1195	1.000	1.000	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
5	Q9H6F0	0.0	701	326	0.273	1.000	Q9H6F0_HUMAN cDNA: FLJ22332 fis, clone HRC05753 OS=Homo sapiens OX=9606 PE=1 SV=1
6	A0A0R4INF0	5.68e-92	327	1570	0.240	0.183	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
7	Q9P1Z0	2.59e-53	206	1013	0.095	0.112	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
8	Q8UVQ4	2.78e-34	143	701	0.061	0.104	KAISO_XENLA Transcriptional regulator Kaiso OS=Xenopus laevis OX=8355 GN=zbtb33 PE=1 SV=2
9	Q86T24	1.69e-33	140	672	0.058	0.103	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
10	Q8BN78	1.58e-32	137	671	0.056	0.100	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
11	Q9BS34	1.29e-31	130	389	0.067	0.206	ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens OX=9606 GN=ZNF670 PE=1 SV=1
12	Q96LW9	1.82e-31	130	406	0.058	0.170	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
13	P52737	4.48e-30	129	540	0.059	0.131	ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens OX=9606 GN=ZNF136 PE=1 SV=1
14	E9QAG8	1.82e-29	126	526	0.071	0.162	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
15	Q7L945	2.54e-29	125	461	0.054	0.139	ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens OX=9606 GN=ZNF627 PE=1 SV=1
16	A0A0U1RQ46	2.85e-29	127	609	0.072	0.141	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
17	A6NJL1	3.16e-29	125	495	0.049	0.119	ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ZSCAN5B PE=1 SV=1
18	Q96NJ3	3.21e-29	127	590	0.063	0.127	ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens OX=9606 GN=ZNF285 PE=1 SV=3
19	Q8IYX0	6.34e-29	123	411	0.063	0.182	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
20	P13682	7.70e-29	125	527	0.059	0.133	ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens OX=9606 GN=ZNF35 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.4e-18	78.5	BTB/POZ domain
2	PF00096 zf-C2H2	4.8e-15	66.2	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	0.041	25.0	zinc-finger C2H2-type
4	PF13894 zf-C2H2_4	7.6e-13	59.1	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	0.0041	28.4	C2H2-type zinc finger
6	PF15909 zf-C2H2_8	24	16.7	C2H2-type zinc ribbon
7	PF12171 zf-C2H2_jaz	0.021	26.3	Zinc-finger double-stranded RNA-binding
8	PF13913 zf-C2HC_2	1.3e+02	13.9	zinc-finger of a C2HC-type
9	PF13465 zf-H2C2_2	1.3e-19	80.9	Zinc-finger double domain
10	PF12874 zf-met	1.8	20.3	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426387

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317872	0.780	E3 ubiquitin-protein ligase RBBP6
2	9606.ENSP00000276893	0.743	E3 ubiquitin-protein ligase UHRF2
3	9606.ENSP00000381053	0.653	Zinc finger MYND domain-containing protein 11
4	9606.ENSP00000285667	0.627	Heat shock 70 kDa protein 13
5	9606.ENSP00000359837	0.614	ZZ-type zinc finger-containing protein 3
6	9606.ENSP00000338217	0.607	Zinc finger protein 532
7	9606.ENSP00000302111	0.605	Methylated-DNA--protein-cysteine methyltransferase
8	9606.ENSP00000479617	0.602	E3 ubiquitin-protein ligase UHRF1
9	9606.ENSP00000307746	0.595	Zinc finger protein 608
10	9606.ENSP00000298854	0.587	43 kDa receptor-associated protein of the synapse
11	9606.ENSP00000446880	0.586	Bromodomain adjacent to zinc finger domain protein 2A
12	9606.ENSP00000307134	0.567	Catenin delta-2
13	9606.ENSP00000395535	0.559	Methyl-CpG-binding protein 2
14	9606.ENSP00000376534	0.541	Bromodomain adjacent to zinc finger domain protein 2B
15	9606.ENSP00000421853	0.530	Ran-binding protein 3-like
16	9606.ENSP00000286744	0.519	ADAMTS-like protein 3
17	9606.ENSP00000249910	0.516	Methyl-CpG-binding domain protein 4
18	9606.ENSP00000269445	0.505	Dymeclin
19	9606.ENSP00000351536	0.504	Sulfhydryl oxidase 2
20	9606.ENSP00000363506	0.500	Ubiquinol-cytochrome-c reductase complex assembly factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.999	sequence-specific DNA binding
GO:0042802	0.998	identical protein binding
GO:1901265	0.995	nucleoside phosphate binding
GO:0008327	0.991	methyl-CpG binding
GO:0042803	0.985	protein homodimerization activity
GO:0140110	0.742	transcription regulator activity
GO:0003690	0.710	double-stranded DNA binding
GO:0003700	0.449	DNA-binding transcription factor activity
GO:1990837	0.391	sequence-specific double-stranded DNA binding
GO:0000981	0.306	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0006355	0.994	regulation of DNA-templated transcription
GO:0009987	0.946	cellular process
GO:0048523	0.920	negative regulation of cellular process
GO:0009892	0.885	negative regulation of metabolic process
GO:0010605	0.879	negative regulation of macromolecule metabolic process
GO:0051172	0.867	negative regulation of nitrogen compound metabolic process
GO:0031324	0.867	negative regulation of cellular metabolic process
GO:0045934	0.864	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.852	negative regulation of DNA-templated transcription
GO:0050896	0.709	response to stimulus
GO:0051716	0.669	cellular response to stimulus
GO:0033554	0.328	cellular response to stress
GO:0048518	0.306	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.695	cytoplasm
GO:0005576	0.372	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]