StarFunc result for job id Q8NAT2

User Input

>input (981 residues)
MSEQERIQECLRKEIRSLLISTKDGLSPQELEKEYLLMVGNHLPLRILGYRSTMELVLDM
PDVVRVCPGAGGTVILKAIPDESTKGIASLVAKQRSSHKLRNSMHKGRPSIYSGPRSHRR
VPYRGRVAPILPAVVKSELKDLLALSPVLLSDFEKAFAKRFGRSFQYMQYGFLSMFEVLN
AASDVISVEQTRAGSLLMLKKSVTEEKPRGCPAGKIFTQPFRMKQGSYSTGFPVAKPCFS
QPTSNMEPPKQIMSMEKTSKLNVVETSRLNHTEKLNQLENTFKSVIAQIGPGGTISSELK
HKIKFVVSKFPEGLFISKLLGEYEVIFKEQLSPKKLGFLNVTELVGALSDILHVEFRKGH
QDLLVFDADKKPLPPVQSDKKIEAKACVSSPPRNSLSTAAVKETVWNCPSKKQKEPQQKI
CKKPNLVVKPLQLQVETNKSELNLAMANHDIPPDAVPNKKLCRLPPLDTSSLIGVFVEYI
ISPSQFYIRIYSRDSSELLEDMMIEMRRCYSNQLVSDRYVMPECFIQPGHLCCVRISEDK
WWYRVIIHRVLEKQEVEVFYPDFGNIGIVQKSSLRFLKCCYTKLPAQAIPCSLAWVRPVE
EHWTSKAILQFQKLCGLKPLVGVVDEYVDGILNIFLCDTSSNEDVYFHHVLRTEGHAIVC
RENISSKGFSELNPLALYTTSSGGPEDIVLTELGYPSQQHYFNEDRKISPQSKESELRIL
DEIPTGMPCLESVTIGDDIWDENWLPLQAKMGKGGDAASHLFTASLGGKNQYSSCKEMPQ
KDWCFSTPKDTWDDSWQPSGLVNGTKVEVHKPEVLGAQEKNTGTNRTQKQLDINGSSDSS
TLPKLEEFCTSLTQSEQSADGSQSEPNNSQTQPKQIQLSTAAPCSTTAVDDSAEKPSGSV
ESSPEILKNEDFSSSRAITLYKDKRQESVDQLSLILSYECQISQKLYIPRSTATAALGAA
ARLATSRSLLHWYPSVKRMEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK05	0.196	0.212	4.179E-8	903	0.103	0.112	A0A140VK05.pdb.gz	A0A140VK05_HUMAN Testicular secretory protein Li 5 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:F4JP43	0.067	0.039	1.198E-3	2037	0.126	0.061	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
3	AFDB:P20945	0.052	0.062	1.601E-2	796	0.111	0.137	P20945.pdb.gz	ABAA_EMENI Conidiophore development regulator abaA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=abaA PE=1 SV=3
4	AFDB:B1AVB1	0.066	0.077	2.467E-2	825	0.080	0.095	B1AVB1.pdb.gz	B1AVB1_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
5	AFDB:B7TB45	0.054	0.059	2.467E-2	886	0.133	0.147	B7TB45.pdb.gz	SPZ2_DROME Neurotrophin 1 OS=Drosophila melanogaster OX=7227 GN=NT1 PE=1 SV=1
6	PDB:3mp8A	0.058	0.106	3.527E-2	513	0.022	0.043	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
7	PDB:5v8f8	0.064	0.115	3.929E-2	519	0.031	0.058	5v8f8.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
8	AFDB:Q9BZV3	0.050	0.043	4.979E-2	1241	0.106	0.084	Q9BZV3.pdb.gz	IMPG2_HUMAN Interphotoreceptor matrix proteoglycan 2 OS=Homo sapiens OX=9606 GN=IMPG2 PE=1 SV=3
9	PDB:7vo0G	0.060	0.354	5.148E-2	131	0.019	0.145	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
10	PDB:7abi7	0.054	0.204	5.434E-2	236	0.023	0.097	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
11	AFDB:Q71F54	0.047	0.051	5.547E-2	894	0.080	0.087	Q71F54.pdb.gz	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
12	AFDB:E9RD40	0.054	0.065	7.670E-2	797	0.078	0.097	E9RD40.pdb.gz	ABAA_ASPFU Conidiophore development regulator abaA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=abaA PE=2 SV=1
13	PDB:3cuqA	0.062	0.239	9.843E-2	219	0.023	0.105	3cuqA.pdb.gz
14	AFDB:Q57UR3	0.046	0.048	1.061E-1	934	0.122	0.128	Q57UR3.pdb.gz	Q57UR3_TRYB2 C2H2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.110 PE=3 SV=1
15	PDB:7azyx	0.055	0.196	1.097E-1	252	0.017	0.067	7azyx.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.
16	PDB:6r8yK	0.046	0.052	1.290E-1	825	0.017	0.021	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
17	PDB:2dybA	0.053	0.143	1.361E-1	298	0.028	0.091	2dybA.pdb.gz
18	PDB:2o03A	0.065	0.411	1.689E-1	129	0.016	0.124	2o03A.pdb.gz	Crystal structure and function of the zinc uptake regulator FurB from Mycobacterium tuberculosis.
19	PDB:6hivDA	0.049	0.036	1.689E-1	1557	0.042	0.026	6hivDA.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	AFDB:Q6NLM8	0.054	0.062	3.674E-1	778	0.055	0.069	Q6NLM8.pdb.gz	Q6NLM8_DROME RE56731p OS=Drosophila melanogaster OX=7227 GN=sano PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VCS6	0.0	1533	1040	0.795	0.750	TDRD5_MOUSE Tudor domain-containing protein 5 OS=Mus musculus OX=10090 GN=Tdrd5 PE=1 SV=3
2	Q9Y2W6	5.16e-17	88.2	561	0.066	0.116	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
3	Q58EK5	1.99e-15	84.0	1175	0.055	0.046	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
4	Q80VL1	8.09e-15	80.9	560	0.066	0.116	TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus OX=10090 GN=Tdrkh PE=1 SV=1
5	Q9BXT4	1.19e-14	81.3	1180	0.051	0.042	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
6	A9CPT4	4.25e-14	79.3	1133	0.053	0.046	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
7	Q8NHU6	1.42e-13	77.8	1098	0.167	0.149	TDRD7_HUMAN Tudor domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TDRD7 PE=1 SV=2
8	Q99MV1	2.64e-12	73.6	1172	0.055	0.046	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
9	P61407	6.47e-10	65.9	2134	0.058	0.027	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
10	F1R237	1.89e-09	64.3	2117	0.040	0.018	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
11	H9JD76	1.35e-08	61.2	629	0.055	0.086	TDRKH_BOMMO Tudor and KH domain-containing protein homolog OS=Bombyx mori OX=7091 GN=PAPI PE=1 SV=2
12	A6NAF9	1.36e-08	61.6	1079	0.055	0.050	TRD7A_DANRE Tudor domain-containing protein 7A OS=Danio rerio OX=7955 GN=tdrd7a PE=2 SV=2
13	A1Z9P1	3.46e-08	59.7	559	0.056	0.098	A1Z9P1_DROME FI02030p OS=Drosophila melanogaster OX=7227 GN=tej PE=2 SV=1
14	Q8SZ14	3.48e-08	59.3	396	0.056	0.139	Q8SZ14_DROME RE23690p OS=Drosophila melanogaster OX=7227 GN=tej PE=2 SV=1
15	Q90WE3	8.97e-08	58.9	1905	0.039	0.020	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
16	Q99MV7	2.11e-07	57.8	1640	0.045	0.027	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
17	Q0E910	6.95e-07	55.8	1222	0.035	0.028	Q0E910_DROME Tapas, isoform B OS=Drosophila melanogaster OX=7227 GN=tapas PE=1 SV=1
18	Q8K1H1	1.84e-06	54.7	1086	0.030	0.027	TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus OX=10090 GN=Tdrd7 PE=1 SV=1
19	Q9R1R4	1.98e-06	54.3	1113	0.030	0.026	TDRD7_RAT Tudor domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Tdrd7 PE=1 SV=1
20	Q14BI7	2.07e-06	54.3	1383	0.040	0.028	TDRD9_MOUSE ATP-dependent RNA helicase TDRD9 OS=Mus musculus OX=10090 GN=Tdrd9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09155 DUF1940	8.5e+02	11.5	Domain of unknown function (DUF1940)
2	PF12872 OST-HTH	5.1e-29	111.3	OST-HTH/LOTUS domain
3	PF00567 TUDOR	5.4e-18	76.6	Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406052

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387303	0.930	ATP-dependent RNA helicase TDRD9
2	9606.ENSP00000390621	0.898	Putative ATP-dependent RNA helicase TDRD12
3	9606.ENSP00000262794	0.864	RNA helicase Mov10l1
4	9606.ENSP00000330031	0.837	Piwi-like protein 3
5	9606.ENSP00000348132	0.808	Serine/threonine kinase 31
6	9606.ENSP00000245255	0.807	Piwi-like protein 1
7	9606.ENSP00000446485	0.793	Gametocyte-specific factor 1
8	9606.ENSP00000349208	0.785	Piwi-like protein 2
9	9606.ENSP00000299001	0.783	Piwi-like protein 4
10	9606.ENSP00000252037	0.776	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
11	9606.ENSP00000356846	0.769	Protein maelstrom homolog
12	9606.ENSP00000359049	0.766	Small RNA 2'-O-methyltransferase
13	9606.ENSP00000284629	0.678	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
14	9606.ENSP00000327832	0.678	Alpha-tubulin N-acetyltransferase 1
15	9606.ENSP00000357465	0.674	Tudor domain-containing protein 10
16	9606.ENSP00000415056	0.649	piRNA biogenesis protein EXD1
17	9606.ENSP00000317177	0.640	Mitochondrial cardiolipin hydrolase
18	9606.ENSP00000379654	0.607	Meiosis regulator and mRNA stability factor 1
19	9606.ENSP00000251864	0.589	Tudor domain-containing protein 1
20	9606.ENSP00000293695	0.581	Synaptonemal complex central element protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.999	heterocyclic compound binding
GO:0097159	0.999	organic cyclic compound binding
GO:0003676	0.981	nucleic acid binding
GO:0003723	0.552	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0032502	0.986	developmental process
GO:0032501	0.981	multicellular organismal process
GO:0006306	0.976	DNA methylation
GO:0007315	0.972	pole plasm assembly
GO:0007283	0.952	spermatogenesis
GO:0006996	0.939	organelle organization
GO:0048515	0.802	spermatid differentiation
GO:0007286	0.504	spermatid development
GO:0065007	0.365	biological regulation
GO:0050789	0.361	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036464	0.996	cytoplasmic ribonucleoprotein granule
GO:0043186	0.989	P granule
GO:0033391	0.975	chromatoid body
GO:0030054	0.964	cell junction
GO:0045202	0.938	synapse
GO:0043231	0.924	intracellular membrane-bounded organelle
GO:0005634	0.740	nucleus
GO:0070013	0.486	intracellular organelle lumen
GO:0005829	0.314	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]