StarFunc result for job id Q8NB12

User Input

>input (490 residues)
MTIGRMENVEVFTAEGKGRGLKATKEFWAADIIFAERAYSAVVFDSLVNFVCHTCFKRQE
KLHRCGQCKFAHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGTG
LTEGCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCN
GFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALG
KISEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQKKLKDDLFLGVKDNPKPSQE
VVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNIYMLRMLSIVSEV
LSYLQAFEEASFYARRMVDGYMKLYHPNNAQLGMAVMRAGLTNWHAGNIEVGHGMICKAY
AILLVTHGPSHPITKDLEAMRVQTEMELRMFRQNEFMYYKMREAALNNQPMQVMAEPSNE
PSPALFHKKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97443	0.954	0.954	1.118E-76	490	0.945	0.945	P97443.pdb.gz	SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus OX=10090 GN=Smyd1 PE=1 SV=3
2	PDB:3n71A	0.922	0.965	2.636E-70	468	0.902	0.944	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
3	AFDB:Q2MJQ9	0.905	0.912	2.363E-58	486	0.637	0.642	Q2MJQ9.pdb.gz	Q2MJQ9_DANRE Histone methyltransferase SmyD1a OS=Danio rerio OX=7955 GN=sth PE=1 SV=1
4	AFDB:Q6P0R5	0.907	0.916	1.164E-56	485	0.590	0.596	Q6P0R5.pdb.gz
5	AFDB:Q5BJI7	0.767	0.856	4.535E-33	435	0.271	0.306	Q5BJI7.pdb.gz	SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio OX=7955 GN=smyd2a PE=2 SV=1
6	AFDB:E7EZZ6	0.788	0.894	2.690E-32	429	0.284	0.324	E7EZZ6.pdb.gz
7	AFDB:Q5RGL7	0.763	0.853	3.952E-32	434	0.247	0.279	Q5RGL7.pdb.gz	SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio OX=7955 GN=smyd2b PE=1 SV=2
8	AFDB:Q7M6Z3	0.767	0.860	5.275E-32	433	0.276	0.312	Q7M6Z3.pdb.gz	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
9	PDB:5v3hA	0.776	0.861	8.944E-32	438	0.271	0.304	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
10	PDB:5ex0A	0.734	0.829	1.323E-30	429	0.273	0.312	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
11	AFDB:Q9CWR2	0.716	0.811	3.492E-29	428	0.282	0.322	Q9CWR2.pdb.gz	SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus OX=10090 GN=Smyd3 PE=2 SV=1
12	AFDB:Q32LV8	0.681	0.867	1.429E-26	380	0.255	0.329	Q32LV8.pdb.gz	Q32LV8_DANRE Histone-lysine N-methyltransferase SMYD3 OS=Danio rerio OX=7955 GN=zgc:123202 PE=1 SV=1
13	AFDB:Q7XJS0	0.772	0.787	2.001E-26	480	0.229	0.233	Q7XJS0.pdb.gz	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
14	PDB:3qxyA	0.340	0.387	5.714E-6	420	0.122	0.143	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
15	PDB:6ox1B	0.339	0.343	6.291E-6	484	0.127	0.128	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
16	PDB:6n3qF	0.228	0.519	6.120E-3	190	0.045	0.116	6n3qF.pdb.gz
17	PDB:5h6zA	0.177	0.616	1.764E-2	123	0.065	0.260	5h6zA.pdb.gz
18	PDB:3wxxG	0.219	0.626	2.243E-2	151	0.027	0.086	3wxxG.pdb.gz	Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly
19	PDB:6ww7B	0.188	0.313	2.719E-2	281	0.047	0.082	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
20	PDB:4gyoB	0.194	0.254	4.400E-2	359	0.057	0.078	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97443	0.0	991	490	0.945	0.945	SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus OX=10090 GN=Smyd1 PE=1 SV=3
2	Q2MJQ8	0.0	664	473	0.624	0.647	Q2MJQ8_DANRE Histone methyltransferase SmyD1b OS=Danio rerio OX=7955 GN=symd1 PE=1 SV=1
3	Q2MJQ9	0.0	689	486	0.637	0.642	Q2MJQ9_DANRE Histone methyltransferase SmyD1a OS=Danio rerio OX=7955 GN=sth PE=1 SV=1
4	Q8NB12	0.0	1035	490	1.000	1.000	SMYD1_HUMAN Histone-lysine N-methyltransferase SMYD1 OS=Homo sapiens OX=9606 GN=SMYD1 PE=1 SV=1
5	Q7M6Z3	8.65e-74	241	433	0.271	0.307	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
6	Q8R5A0	5.74e-73	239	433	0.273	0.309	SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus OX=10090 GN=Smyd2 PE=1 SV=1
7	Q5BJI7	3.81e-72	237	435	0.273	0.308	SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio OX=7955 GN=smyd2a PE=2 SV=1
8	Q9NRG4	3.18e-71	234	433	0.273	0.309	SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2 PE=1 SV=2
9	Q9CWR2	4.94e-69	228	428	0.282	0.322	SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus OX=10090 GN=Smyd3 PE=2 SV=1
10	Q5RGL7	7.82e-68	226	434	0.249	0.281	SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio OX=7955 GN=smyd2b PE=1 SV=2
11	Q9H7B4	1.47e-66	222	428	0.276	0.315	SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 PE=1 SV=4
12	Q32LV8	1.04e-58	200	380	0.276	0.355	Q32LV8_DANRE Histone-lysine N-methyltransferase SMYD3 OS=Danio rerio OX=7955 GN=zgc:123202 PE=1 SV=1
13	Q7XJS0	4.56e-38	147	480	0.231	0.235	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
14	O94256	1.78e-18	90.1	483	0.137	0.139	SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set6 PE=3 SV=1
15	Q8I4F7	1.00e-16	85.1	507	0.173	0.168	SMYDL_CAEEL Histone-lysine N-methyltransferase set-18 OS=Caenorhabditis elegans OX=6239 GN=set-18 PE=1 SV=1
16	Q23084	5.21e-10	63.9	560	0.129	0.113	Q23084_CAEEL MYND-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=set-30 PE=1 SV=3
17	Q8IDE8	7.28e-10	63.5	509	0.118	0.114	Q8IDE8_PLAF7 Histone-lysine N-methyltransferase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1355300 PE=4 SV=1
18	Q57XB8	8.80e-10	63.5	713	0.078	0.053	Q57XB8_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.790 PE=4 SV=1
19	Q582H7	2.89e-08	58.2	429	0.078	0.089	Q582H7_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.380 PE=4 SV=1
20	Q95RZ8	4.04e-08	58.2	567	0.145	0.125	Q95RZ8_DROME SET and MYND domain-containing protein 4 OS=Drosophila melanogaster OX=7227 GN=Smyd4-3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10231 COA8	1e+02	14.5	Cytochrome c oxidase assembly factor 8
2	PF00856 SET	1.6e-08	46.6	SET domain
3	PF01753 zf-MYND	4.3e-05	34.8	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448035	0.991	Nascent polypeptide-associated complex subunit alpha, muscle-specific form
2	9606.ENSP00000268876	0.870	Protein unc-45 homolog B
3	9606.ENSP00000362649	0.775	Histone deacetylase 1
4	9606.ENSP00000378132	0.768	Iroquois-class homeodomain protein IRX-5
5	9606.ENSP00000217173	0.747	RING finger protein 37
6	9606.ENSP00000364405	0.740	Zinc finger protein 367
7	9606.ENSP00000331172	0.738	T-cell surface glycoprotein CD8 beta chain
8	9606.ENSP00000305244	0.733	Iroquois-class homeodomain protein IRX-1
9	9606.ENSP00000333496	0.726	Potassium voltage-gated channel subfamily D member 2
10	9606.ENSP00000374152	0.719	SET and MYND domain-containing protein 5
11	9606.ENSP00000467141	0.719	Titin
12	9606.ENSP00000357189	0.718	Hepatoma-derived growth factor
13	9606.ENSP00000327323	0.706	Threonine synthase-like 2
14	9606.ENSP00000295834	0.694	Fatty acid-binding protein, liver
15	9606.ENSP00000367755	0.683	Calmodulin-lysine N-methyltransferase
16	9606.ENSP00000262113	0.681	Myomesin-2
17	9606.ENSP00000352565	0.668	Heart- and neural crest derivatives-expressed protein 2
18	9606.ENSP00000369666	0.667	F-box/LRR-repeat protein 19
19	9606.ENSP00000306997	0.663	Myozenin-2
20	9606.ENSP00000196061	0.658	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.972	catalytic activity, acting on a protein
GO:0016740	0.949	transferase activity
GO:0008276	0.941	protein methyltransferase activity
GO:0042054	0.932	histone methyltransferase activity
GO:0016279	0.930	protein-lysine N-methyltransferase activity
GO:0140110	0.927	transcription regulator activity
GO:0018024	0.918	histone lysine N-methyltransferase activity
GO:0003712	0.861	transcription coregulator activity
GO:0003714	0.847	transcription corepressor activity
GO:0140938	0.545	histone H3 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0048856	0.928	anatomical structure development
GO:0048518	0.905	positive regulation of biological process
GO:0032501	0.859	multicellular organismal process
GO:0048522	0.850	positive regulation of cellular process
GO:0019222	0.789	regulation of metabolic process
GO:0051147	0.778	regulation of muscle cell differentiation
GO:0060255	0.767	regulation of macromolecule metabolic process
GO:0048519	0.725	negative regulation of biological process
GO:0080090	0.725	regulation of primary metabolic process
GO:0051171	0.725	regulation of nitrogen compound metabolic process
GO:0048523	0.719	negative regulation of cellular process
GO:0045661	0.710	regulation of myoblast differentiation
GO:0031323	0.701	regulation of cellular metabolic process
GO:0051153	0.652	regulation of striated muscle cell differentiation
GO:0071840	0.647	cellular component organization or biogenesis
GO:0019219	0.620	regulation of nucleobase-containing compound metabolic process
GO:0016043	0.619	cellular component organization
GO:0010468	0.614	regulation of gene expression
GO:0048513	0.584	animal organ development
GO:0051094	0.582	positive regulation of developmental process
GO:0010830	0.581	regulation of myotube differentiation
GO:0009889	0.532	regulation of biosynthetic process
GO:2001141	0.508	regulation of RNA biosynthetic process
GO:0006355	0.489	regulation of DNA-templated transcription
GO:0045597	0.411	positive regulation of cell differentiation
GO:0008152	0.404	metabolic process
GO:0051172	0.374	negative regulation of nitrogen compound metabolic process
GO:0071704	0.370	organic substance metabolic process
GO:0007275	0.368	multicellular organism development
GO:0010605	0.366	negative regulation of macromolecule metabolic process
GO:0061061	0.350	muscle structure development
GO:0006807	0.332	nitrogen compound metabolic process
GO:1903507	0.325	negative regulation of nucleic acid-templated transcription
GO:0045892	0.323	negative regulation of DNA-templated transcription
GO:0048731	0.315	system development
GO:0007517	0.311	muscle organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0031981	0.980	nuclear lumen
GO:0005654	0.967	nucleoplasm
GO:0043228	0.883	non-membrane-bounded organelle
GO:0043232	0.871	intracellular non-membrane-bounded organelle
GO:0099512	0.467	supramolecular fiber
GO:0030016	0.455	myofibril
GO:0030017	0.451	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.949	Transferases.
EC:2.1.1.-	0.943	Methyltransferases.
RHEA:51736	0.930	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]