StarFunc result for job id Q8NB14

User Input

>input (1042 residues)
MDKILEGLVSSSHPLPLKRVIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPQLCARLSDLLTDFVQCIPKGKLSITFCQQLVRTIGHFQC
VSTQERELREYVSQVTKVSNLLQNIWKAEPATLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVNLVH
SFKNDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS
AWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEE
KILKVQASHKPSEILECSETSLQEVASKAAVLTETPRTSDGEKTLIEKMFGGKLRTHIRC
LNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDPASSPSIQDGGLMQASVPGPSEEPVVY
NPTTAAFICDSLVNEKTIGSPPNEFYCSENTSVPNESNKILVNKDVPQKPGGETTPSVTD
LLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKI
LDNVSLPLVLELPVKRITSFSSLSESWSVDVDFTDLSENLAKKLKPSGTDEASCTKLVPY
LLSSVVVHSGISSESGHYYSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVF
EQDLENKEMSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQHSTNGLSGNNP
TSGLWINGDPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPP
GSCGPTGGGGGGGFNTVGRLVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NB14	1.000	1.000	0.000	1042	1.000	1.000	Q8NB14.pdb.gz	UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens OX=9606 GN=USP38 PE=1 SV=2
2	AFDB:Q9P2H5	0.530	0.541	6.719E-78	1018	0.441	0.452	Q9P2H5.pdb.gz	UBP35_HUMAN Ubiquitin carboxyl-terminal hydrolase 35 OS=Homo sapiens OX=9606 GN=USP35 PE=1 SV=3
3	PDB:5cvnB	0.276	0.867	3.621E-21	321	0.104	0.336	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
4	AFDB:Q8BY87	0.294	0.225	8.877E-21	1376	0.124	0.094	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
5	PDB:7yxxA	0.286	0.185	2.792E-19	1754	0.156	0.093	7yxxA.pdb.gz
6	AFDB:Q22240	0.286	0.228	6.846E-18	1326	0.110	0.087	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
7	PDB:5k16B	0.257	0.771	1.658E-17	328	0.101	0.320	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
8	PDB:7ay1D	0.264	0.775	4.133E-15	341	0.097	0.296	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
9	PDB:3mhsA	0.256	0.562	4.708E-15	455	0.093	0.213	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
10	PDB:7w3ax	0.256	0.513	2.250E-14	494	0.094	0.198	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
11	PDB:8a9kD	0.236	0.818	2.677E-14	285	0.092	0.337	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
12	AFDB:E7F4C0	0.243	0.230	7.809E-14	1104	0.097	0.091	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
13	AFDB:B1AQJ2	0.252	0.240	3.573E-13	1098	0.097	0.092	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
14	AFDB:Q9H9J4	0.256	0.203	4.440E-13	1324	0.097	0.076	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
15	AFDB:Q6PAW2	0.261	0.300	6.565E-13	901	0.118	0.137	Q6PAW2.pdb.gz	UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis OX=8355 GN=usp16 PE=2 SV=1
16	AFDB:A0A024R8V6	0.247	0.230	6.856E-13	1123	0.094	0.087	A0A024R8V6.pdb.gz
17	AFDB:B2RQC2	0.248	0.197	7.479E-13	1324	0.095	0.075	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
18	PDB:5k1bA	0.223	0.800	1.225E-12	264	0.095	0.375	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
19	PDB:5gjqx	0.244	0.672	1.458E-12	355	0.085	0.251	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:4fjcE	0.228	0.516	1.226E-11	434	0.087	0.210	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NB14	0.0	2156	1042	1.000	1.000	UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens OX=9606 GN=USP38 PE=1 SV=2
2	Q9P2H5	0.0	581	1018	0.288	0.295	UBP35_HUMAN Ubiquitin carboxyl-terminal hydrolase 35 OS=Homo sapiens OX=9606 GN=USP35 PE=1 SV=3
3	A2RRA6	4.69e-48	184	604	0.137	0.237	A2RRA6_HUMAN USP35 protein OS=Homo sapiens OX=9606 GN=USP35 PE=1 SV=1
4	Q7JQI1	1.05e-42	171	852	0.108	0.133	Q7JQI1_DROME Deubiquitinating apoptotic inhibitor, isoform A OS=Drosophila melanogaster OX=7227 GN=DUBAI PE=2 SV=1
5	Q22240	6.38e-15	82.4	1326	0.071	0.056	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
6	Q6P8X6	2.22e-14	78.6	390	0.059	0.156	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
7	F1M625	4.39e-14	77.4	366	0.060	0.172	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
8	E9QFQ5	5.27e-14	77.8	404	0.054	0.139	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
9	P62068	9.81e-14	76.3	366	0.060	0.172	UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens OX=9606 GN=USP46 PE=1 SV=1
10	P62069	9.81e-14	76.3	366	0.060	0.172	UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus OX=10090 GN=Usp46 PE=1 SV=1
11	Q8W4N3	1.17e-13	78.2	961	0.058	0.062	UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=UBP2 PE=1 SV=2
12	Q5U349	3.38e-13	76.3	618	0.065	0.110	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
13	A0A8I6A0C2	3.61e-13	75.5	482	0.058	0.124	A0A8I6A0C2_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
14	P39538	7.08e-13	75.5	1254	0.069	0.057	UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP12 PE=1 SV=1
15	P34547	1.20e-12	73.6	426	0.060	0.148	UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans OX=6239 GN=usp-46 PE=1 SV=3
16	P32571	1.24e-12	74.7	926	0.058	0.065	UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOA4 PE=1 SV=2
17	A0A0R4IB93	1.27e-12	74.7	1047	0.044	0.044	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
18	O60079	1.34e-12	74.7	979	0.062	0.066	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
19	D4A4F6	1.39e-12	73.6	476	0.072	0.158	D4A4F6_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=4
20	H1UUC2	1.42e-12	72.8	367	0.050	0.142	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10228 DUF2228	2.7e+02	12.6	Uncharacterised conserved protein (DUF2228)
2	PF00443 UCH	4.7e-44	162.6	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	3.7e-14	64.7	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357459	0.671	Double-stranded RNA-specific adenosine deaminase
2	9606.ENSP00000471735	0.667	Probable protease (By similarity). Acts as a sensor of N(6)- methyladenosine methylation on DNA (m6A): recognizes and binds m6A DNA, leading to its degradation .
3	9606.ENSP00000262947	0.656	Myeloid-derived growth factor
4	9606.ENSP00000285420	0.633	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
5	9606.ENSP00000307491	0.598	WD repeat-containing protein 48
6	9606.ENSP00000074304	0.568	Type I inositol 3,4-bisphosphate 4-phosphatase
7	9606.ENSP00000342105	0.561	Dual specificity tyrosine-phosphorylation-regulated kinase 2
8	9606.ENSP00000356065	0.559	Interleukin-20
9	9606.ENSP00000269499	0.557	Zinc finger CCHC-type containing 2
10	9606.ENSP00000263966	0.556	Ubiquitin carboxyl-terminal hydrolase 13
11	9606.ENSP00000232165	0.547	Ubiquitin-protein ligase E3A
12	9606.ENSP00000375795	0.546	Interleukin-24
13	9606.ENSP00000423390	0.546	Ubiquitin carboxyl-terminal hydrolase 26
14	9606.ENSP00000260327	0.529	CTD small phosphatase-like protein 2
15	9606.ENSP00000404092	0.528	Structural maintenance of chromosomes protein 6
16	9606.ENSP00000309031	0.527	Deubiquitinating protein VCIP135
17	9606.ENSP00000229268	0.526	Ubiquitin carboxyl-terminal hydrolase 5
18	9606.ENSP00000312981	0.524	U4/U6.U5 tri-snRNP-associated protein 2
19	9606.ENSP00000401721	0.522	PAN2-PAN3 deadenylation complex catalytic subunit PAN2
20	9606.ENSP00000255499	0.516	E3 ubiquitin-protein ligase RNF128

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006508	0.995	proteolysis
GO:0016579	0.993	protein deubiquitination
GO:0050789	0.607	regulation of biological process
GO:0050794	0.532	regulation of cellular process
GO:0009987	0.404	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0005634	0.984	nucleus
GO:0070013	0.965	intracellular organelle lumen
GO:0005829	0.959	cytosol
GO:0031981	0.950	nuclear lumen
GO:0005654	0.851	nucleoplasm
GO:0043228	0.477	non-membrane-bounded organelle
GO:0043232	0.453	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]