StarFunc result for job id Q8NB16

User Input

>input (471 residues)
MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTT
AMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQ
RMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYL
PPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSI
AIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD
LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMS
LGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI
RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NB16	1.000	1.000	1.491E-71	471	1.000	1.000	Q8NB16.pdb.gz	MLKL_HUMAN Mixed lineage kinase domain-like protein OS=Homo sapiens OX=9606 GN=MLKL PE=1 SV=1
2	AFDB:Q9D2Y4	0.614	0.612	6.276E-45	472	0.607	0.606	Q9D2Y4.pdb.gz	MLKL_MOUSE Mixed lineage kinase domain-like protein OS=Mus musculus OX=10090 GN=Mlkl PE=1 SV=1
3	PDB:4btfA	0.574	0.653	1.127E-40	413	0.569	0.649	4btfA.pdb.gz
4	PDB:6lk5A	0.515	0.890	1.228E-34	265	0.561	0.996	6lk5A.pdb.gz
5	AFDB:F4HVH9	0.504	0.319	6.171E-17	765	0.180	0.111	F4HVH9.pdb.gz	F4HVH9_ARATH PAS domain-containing protein tyrosine kinase family protein OS=Arabidopsis thaliana OX=3702 GN=RAF11 PE=1 SV=1
6	AFDB:A0A384KC16	0.469	0.555	1.237E-16	391	0.170	0.205	A0A384KC16.pdb.gz	A0A384KC16_ARATH ATMRK1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57540 PE=1 SV=1
7	AFDB:O82754	0.496	0.324	1.488E-16	736	0.161	0.103	O82754.pdb.gz	O82754_ARATH PAS domain-containing protein tyrosine kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g23050 PE=1 SV=1
8	AFDB:Q2MHE4	0.463	0.551	2.366E-16	390	0.178	0.215	Q2MHE4.pdb.gz	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
9	AFDB:Q54I36	0.456	0.169	6.868E-16	1338	0.225	0.079	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
10	AFDB:Q8S9K4	0.492	0.273	7.892E-16	880	0.170	0.091	Q8S9K4.pdb.gz	Q8S9K4_ARATH AT5g11850/F14F18_20 OS=Arabidopsis thaliana OX=3702 GN=MKD1 PE=1 SV=1
11	AFDB:Q86AT8	0.481	0.361	8.267E-16	638	0.195	0.144	Q86AT8.pdb.gz	SPKA_DICDI Stress-activated protein kinase alpha OS=Dictyostelium discoideum OX=44689 GN=spkA-1 PE=1 SV=1
12	AFDB:Q9FGB1	0.469	0.564	9.499E-16	385	0.159	0.195	Q9FGB1.pdb.gz	Q9FGB1_ARATH Protein kinase OS=Arabidopsis thaliana OX=3702 GN=CBC2 PE=1 SV=1
13	PDB:6s73A	0.434	0.727	5.876E-12	269	0.142	0.249	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
14	PDB:4fl2A	0.480	0.412	6.446E-12	555	0.142	0.121	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:2h8hA	0.482	0.507	1.629E-11	445	0.134	0.142	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:7mfdA	0.453	0.513	2.151E-11	410	0.144	0.166	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
17	PDB:8dksA	0.402	0.633	2.253E-11	283	0.134	0.223	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:1k9aB	0.451	0.479	4.114E-11	441	0.125	0.134	1k9aB.pdb.gz
19	PDB:3eqdA	0.459	0.660	4.114E-11	315	0.125	0.187	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
20	PDB:2bujA	0.428	0.663	1.310E-10	291	0.127	0.206	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NB16	0.0	971	471	1.000	1.000	MLKL_HUMAN Mixed lineage kinase domain-like protein OS=Homo sapiens OX=9606 GN=MLKL PE=1 SV=1
2	Q9D2Y4	0.0	561	472	0.605	0.604	MLKL_MOUSE Mixed lineage kinase domain-like protein OS=Mus musculus OX=10090 GN=Mlkl PE=1 SV=1
3	I3L2T9	4.04e-152	432	211	0.448	1.000	I3L2T9_HUMAN Mixed lineage kinase domain like pseudokinase (Fragment) OS=Homo sapiens OX=9606 GN=MLKL PE=1 SV=1
4	F4HVH9	5.77e-32	131	765	0.170	0.105	F4HVH9_ARATH PAS domain-containing protein tyrosine kinase family protein OS=Arabidopsis thaliana OX=3702 GN=RAF11 PE=1 SV=1
5	Q2MHE4	2.36e-27	115	390	0.161	0.195	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
6	Q9LVQ9	3.72e-27	114	405	0.180	0.210	Q9LVQ9_ARATH Protein kinase ATN1-like protein OS=Arabidopsis thaliana OX=3702 GN=MSN2.10 PE=1 SV=1
7	O82754	4.98e-27	117	736	0.163	0.105	O82754_ARATH PAS domain-containing protein tyrosine kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g23050 PE=1 SV=1
8	Q8S9K4	5.85e-27	117	880	0.157	0.084	Q8S9K4_ARATH AT5g11850/F14F18_20 OS=Arabidopsis thaliana OX=3702 GN=MKD1 PE=1 SV=1
9	Q9M085	7.64e-27	114	412	0.155	0.177	Q9M085_ARATH AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=RAF28 PE=1 SV=1
10	Q05609	7.91e-26	113	821	0.172	0.099	CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana OX=3702 GN=CTR1 PE=1 SV=1
11	Q54I36	3.57e-25	111	1338	0.168	0.059	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
12	Q54H46	6.29e-25	110	642	0.155	0.114	DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum OX=44689 GN=drkA PE=3 SV=1
13	Q54QQ1	8.41e-25	110	1387	0.163	0.056	PHG2_DICDI Serine/threonine-protein kinase phg2 OS=Dictyostelium discoideum OX=44689 GN=phg2 PE=1 SV=1
14	Q9FPR3	2.70e-24	108	933	0.155	0.078	EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana OX=3702 GN=EDR1 PE=1 SV=1
15	Q9C9U5	3.57e-24	108	1030	0.159	0.073	SIS8_ARATH Probable serine/threonine-protein kinase SIS8 OS=Arabidopsis thaliana OX=3702 GN=SIS8 PE=1 SV=1
16	Q54RB7	5.29e-24	107	527	0.172	0.154	SHKA_DICDI Dual specificity protein kinase shkA OS=Dictyostelium discoideum OX=44689 GN=shkA PE=2 SV=1
17	Q9ZQ31	1.22e-23	104	411	0.151	0.173	STY13_ARATH Serine/threonine-protein kinase STY13 OS=Arabidopsis thaliana OX=3702 GN=STY13 PE=1 SV=2
18	Q80XI6	1.35e-23	106	850	0.155	0.086	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
19	Q66HA1	1.40e-23	106	850	0.155	0.086	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
20	Q60700	1.43e-23	106	888	0.166	0.088	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	4.4e-27	106.7	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	5.8e-37	138.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216274	0.989	Receptor-interacting serine/threonine-protein kinase 3
2	9606.ENSP00000438465	0.985	Serine/threonine-protein phosphatase PGAM5, mitochondrial
3	9606.ENSP00000337383	0.932	NACHT, LRR and PYD domains-containing protein 3
4	9606.ENSP00000351273	0.927	Caspase-8
5	9606.ENSP00000335153	0.914	Heat shock protein HSP 90-alpha
6	9606.ENSP00000320239	0.906	Transient receptor potential cation channel subfamily M member 7
7	9606.ENSP00000259808	0.844	Receptor-interacting serine/threonine-protein kinase 1
8	9606.ENSP00000301838	0.841	FAS-associated death domain protein
9	9606.ENSP00000360609	0.840	Heat shock protein HSP 90-beta
10	9606.ENSP00000308024	0.837	Neuroendocrine convertase 1
11	9606.ENSP00000222005	0.727	Hsp90 co-chaperone Cdc37
12	9606.ENSP00000341268	0.707	Tumor necrosis factor receptor type 1-associated DEATH domain protein
13	9606.ENSP00000433209	0.704	Gasdermin-D
14	9606.ENSP00000162749	0.695	Tumor necrosis factor receptor superfamily member 1A
15	9606.ENSP00000398495	0.691	Diablo homolog, mitochondrial
16	9606.ENSP00000392025	0.690	Ubiquitin carboxyl-terminal hydrolase CYLD
17	9606.ENSP00000324205	0.689	Charged multivesicular body protein 4a
18	9606.ENSP00000433138	0.684	Caspase-1
19	9606.ENSP00000477613	0.681	Baculoviral IAP repeat-containing protein 2
20	9606.ENSP00000219368	0.675	Fatty acid 2-hydroxylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005524	0.998	ATP binding
GO:0003824	0.985	catalytic activity
GO:0004672	0.961	protein kinase activity
GO:0042802	0.949	identical protein binding
GO:0044877	0.711	protein-containing complex binding
GO:0019899	0.550	enzyme binding
GO:0004674	0.414	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051716	0.998	cellular response to stimulus
GO:0023052	0.996	signaling
GO:0007154	0.996	cell communication
GO:0070265	0.983	necrotic cell death
GO:0007165	0.975	signal transduction
GO:0012501	0.928	programmed cell death
GO:0071840	0.870	cellular component organization or biogenesis
GO:0016043	0.861	cellular component organization
GO:0043933	0.816	protein-containing complex organization
GO:0022607	0.790	cellular component assembly
GO:0065003	0.768	protein-containing complex assembly
GO:0051259	0.722	protein complex oligomerization
GO:0051260	0.623	protein homooligomerization
GO:0019222	0.548	regulation of metabolic process
GO:0070207	0.527	protein homotrimerization
GO:0006950	0.480	response to stress
GO:0048518	0.460	positive regulation of biological process
GO:0060255	0.460	regulation of macromolecule metabolic process
GO:0048522	0.416	positive regulation of cellular process
GO:0008152	0.413	metabolic process
GO:0071704	0.403	organic substance metabolic process
GO:0080090	0.391	regulation of primary metabolic process
GO:0051171	0.390	regulation of nitrogen compound metabolic process
GO:0048583	0.385	regulation of response to stimulus
GO:0048519	0.357	negative regulation of biological process
GO:0006807	0.356	nitrogen compound metabolic process
GO:1901564	0.352	organonitrogen compound metabolic process
GO:0044419	0.341	biological process involved in interspecies interaction between organisms
GO:0009605	0.337	response to external stimulus
GO:0031323	0.315	regulation of cellular metabolic process
GO:0010646	0.314	regulation of cell communication
GO:0048523	0.314	negative regulation of cellular process
GO:0023051	0.304	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0005829	0.993	cytosol
GO:0043231	0.826	intracellular membrane-bounded organelle
GO:0005634	0.499	nucleus
GO:0032991	0.369	protein-containing complex
GO:0030054	0.318	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.961	Phosphotransferases with an alcohol group as acceptor.

[back to server]