StarFunc result for job id Q8NB25

User Input

>input (1140 residues)
MATPGMSWQQHYYGGSAAKFAPSPATAQLAGHSMDYSQEMHLKMSKKIAQLTKVIYALNT
KNDEHESAIQALKDAHEEEIQQILAETREKILQYKSKVTEELDLRRKIQVLESSLEDHIK
MKQQALTEFEAYKHRVEDMQLCAEAQHVQRIVTMSREVEEIRRKFEEKLRSFGQLQVQFE
KDKRLALEDLQAAHRREIQELLKSQQDHSASVNKGQEKAEELHRMEVESLNKMLEELRLE
RKKLIEDYEGKLNKAQSFYERELDTLKRSQLFTAESLQASKEKEADLRKEFQGQEAILRK
TIGKLKTELQMVQDEAGSLLDKCQKLQTALAIAENNVQVLQKQLDDAKEGEMALLSKHKE
VESELAAARERLQQQASDLVLKASHIGMLQATQMTQEVTIKDLESEKSRVNERLSQLEEE
RAFLRSKTQSLDEEQKQQILELEKKVNEAKRTQQEYYERELKNLQSRLEEEVTQLNEAHS
KTLEELAWKHHMAIEAVHSNAIRDKKKLQMDLEEQHNKDKLNLEEDKNQLQQELENLKEV
LEDKLNTANQEIGHLQDMVRKSEQGLGSAEGLIASLQDSQERLQNELDLTKDSLKETKDA
LLNVEGELEQERQQHEETIAAMKEEEKLKVDKMAHDLEIKWTENLRQECSKLREELRLQH
EEDKKSAMSQLLQLKDREKNAARDSWQKKVEDLLNQISLLKQNLEIQLSQSQTSLQQLQA
QFTQERQRLTQELEELEEQHQQRHKSLKEAHVLAFQTMEEEKEKEQRALENHLQQKHSAE
LQSLKDAHRESMEGFRIEMEQELQTLRFELEDEGKAMLASLRSELNHQHAAAIDLLRHNH
HQELAAAKMELERSIDISRRQSKEHICRITDLQEELRHREHHISELDKEVQHLHENISAL
TKELEFKGKEILRIRSESNQQIRLHEQDLNKRLEKELDVMTADHLREKNIMRADFNKTNE
LLKEINAALQVSLEEMEEKYLMRESKPEDIQMITELKAMLTERDQIIKKLIEDNKFYQLE
LVNRETNFNKVFNSSPTVGVINPLAKQKKKNDKSPTNRFVSVPNLSALESGGVGNGHPNR
LDPIPNSPVHDIEFNSSKPLPQPVPPKGPKTFLSPAQSEASPVASPDPQRQEWFARYFTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NB25	1.000	1.000	0.000	1140	1.000	1.000	Q8NB25.pdb.gz	F184A_HUMAN Protein FAM184A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=3
2	AFDB:Q38E32	0.133	0.151	1.174E-7	985	0.193	0.223	Q38E32.pdb.gz	Q38E32_TRYB2 Protein FAM184A/B N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1230 PE=4 SV=1
3	AFDB:Q02455	0.104	0.071	5.977E-4	1875	0.202	0.123	Q02455.pdb.gz	MLP1_YEAST Protein MLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP1 PE=1 SV=2
4	AFDB:Q86KX8	0.099	0.072	1.504E-3	1781	0.192	0.123	Q86KX8.pdb.gz	Q86KX8_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272368 PE=4 SV=2
5	AFDB:Q9UFE4	0.106	0.124	2.385E-3	941	0.155	0.188	Q9UFE4.pdb.gz	CCD39_HUMAN Coiled-coil domain-containing protein 39 OS=Homo sapiens OX=9606 GN=CCDC39 PE=2 SV=3
6	AFDB:E2R1I5	0.112	0.132	2.576E-3	939	0.149	0.181	E2R1I5.pdb.gz	CCD39_CANLF Coiled-coil domain-containing protein 39 OS=Canis lupus familiaris OX=9615 GN=CCDC39 PE=3 SV=1
7	AFDB:Q9SAF6	0.108	0.109	2.576E-3	1128	0.153	0.154	Q9SAF6.pdb.gz	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
8	AFDB:Q499E4	0.075	0.106	8.164E-3	774	0.082	0.120	Q499E4.pdb.gz	DZI1L_MOUSE Cilium assembly protein DZIP1L OS=Mus musculus OX=10090 GN=Dzip1l PE=1 SV=1
9	AFDB:B3KNK9	0.076	0.173	8.816E-3	401	0.039	0.110	B3KNK9.pdb.gz	B3KNK9_HUMAN Epididymis luminal protein 46 OS=Homo sapiens OX=9606 GN=GOLPH2 PE=2 SV=1
10	AFDB:Q5EE04	0.093	0.058	8.816E-3	1997	0.181	0.103	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
11	PDB:7ktrE	0.030	0.190	2.342	124	0.016	0.145	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
12	PDB:7r5jV0	0.052	0.184	3.441	273	0.036	0.150	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:5b3dB	0.046	0.326	4.680	117	0.022	0.214	5b3dB.pdb.gz
14	PDB:6v8oO	0.037	0.089	5.054	384	0.013	0.039	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
15	PDB:6wucH	0.041	0.185	6.365	179	0.018	0.117	6wucH.pdb.gz
16	PDB:6c24C	0.031	0.147	8.657	148	0.019	0.149	6c24C.pdb.gz	Structures of human PRC2 with its cofactors AEBP2 and JARID2.
17	PDB:7mqaSS	0.033	0.095	8.657	350	0.014	0.046	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:8at3A	0.067	0.223	9.349	286	0.028	0.112	8at3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P9G8	0.0	2203	1107	0.969	0.998	Q6P9G8_HUMAN Family with sequence similarity 184, member A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=2
2	Q8NB25	0.0	2286	1140	1.000	1.000	F184A_HUMAN Protein FAM184A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=3
3	Q38E32	2.97e-11	70.5	985	0.028	0.032	Q38E32_TRYB2 Protein FAM184A/B N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1230 PE=4 SV=1
4	Q9BVG8	0.008	42.7	833	0.061	0.083	KIFC3_HUMAN Kinesin-like protein KIFC3 OS=Homo sapiens OX=9606 GN=KIFC3 PE=1 SV=4
5	F5H3M2	0.011	42.4	724	0.061	0.095	F5H3M2_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIFC3 PE=1 SV=1
6	O35231	0.016	42.0	824	0.062	0.086	KIFC3_MOUSE Kinesin-like protein KIFC3 OS=Mus musculus OX=10090 GN=Kifc3 PE=1 SV=4
7	R4GDZ5	0.066	40.0	1938	0.068	0.040	R4GDZ5_DANRE Myosin, heavy chain 7B, cardiac muscle, beta a OS=Danio rerio OX=7955 GN=myh7b PE=1 SV=3
8	H2L0I2	0.097	39.7	2396	0.093	0.044	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
9	H2L0I4	0.10	39.3	2392	0.093	0.044	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
10	H2L0I3	0.16	38.9	2323	0.093	0.046	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
11	E7EYJ3	0.40	37.4	903	0.046	0.059	E7EYJ3_DANRE Hyaluronan-mediated motility receptor (RHAMM) OS=Danio rerio OX=7955 GN=wu:fb43e12 PE=4 SV=4
12	Q4G051	0.44	37.0	638	0.061	0.110	Q4G051_RAT Numa1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Numa1 PE=2 SV=1
13	A0A0R4INI3	0.90	36.2	1938	0.065	0.038	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
14	Q508P8	0.98	36.2	1938	0.065	0.038	Q508P8_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=im:6897999 PE=1 SV=1
15	Q69YQ0	1.4	35.4	1117	0.017	0.017	CYTSA_HUMAN Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=3
16	Q9Z220	1.5	35.4	712	0.068	0.108	TSG10_RAT Testis-specific gene 10 protein OS=Rattus norvegicus OX=10116 GN=Tsga10 PE=1 SV=2
17	M9MRD6	1.9	35.4	11999	0.110	0.010	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
18	A0A494C1J1	2.0	35.0	1136	0.017	0.017	A0A494C1J1_HUMAN Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=1
19	M9MRF5	2.0	35.4	11986	0.110	0.010	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
20	Q9LTY1	2.1	35.0	726	0.037	0.058	MAD1_ARATH Mitotic spindle checkpoint protein MAD1 OS=Arabidopsis thaliana OX=3702 GN=MAD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15665 FAM184	4.3e-84	293.0	Family with sequence similarity 184, A and B

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342604

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368152	0.751	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6
2	9606.ENSP00000377664	0.728	GTPase-activating protein and VPS9 domain-containing protein 1
3	9606.ENSP00000450461	0.572	Centrosomal protein 95
4	9606.ENSP00000365898	0.541	Forkhead box protein B2
5	9606.ENSP00000394394	0.513	Anaphase-promoting complex subunit 7
6	9606.ENSP00000412886	0.505	Calmodulin-binding transcription activator 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.878	cellular process
GO:0065007	0.770	biological regulation
GO:0050789	0.515	regulation of biological process
GO:0050794	0.476	regulation of cellular process
GO:0071840	0.439	cellular component organization or biogenesis
GO:0016043	0.398	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.994	extracellular space
GO:0043226	0.957	organelle
GO:0005622	0.956	intracellular anatomical structure
GO:0043229	0.940	intracellular organelle
GO:0043227	0.872	membrane-bounded organelle
GO:0005737	0.821	cytoplasm
GO:0043231	0.812	intracellular membrane-bounded organelle
GO:0016020	0.699	membrane
GO:0043228	0.677	non-membrane-bounded organelle
GO:0043232	0.673	intracellular non-membrane-bounded organelle
GO:0070013	0.578	intracellular organelle lumen
GO:0031981	0.509	nuclear lumen
GO:0015630	0.412	microtubule cytoskeleton
GO:0005654	0.390	nucleoplasm
GO:0071944	0.356	cell periphery
GO:0012505	0.316	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]