StarFunc result for job id Q8NB37

User Input

>input (220 residues)
MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESN
ARWVQDFRLKAYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKP
ICAVGHGVAALCCATNEDRSWVFDSYSLTGPSVCELVRAPGFARLPLVVEDFVKDSGACF
SASEPDAVHVVLDRHLVTGQNASSTVPAVQNLLFLCGSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NB37	1.000	1.000	1.533E-48	220	1.000	1.000	Q8NB37.pdb.gz	GALD1_HUMAN Glutamine amidotransferase-like class 1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GATD1 PE=1 SV=1
2	AFDB:Q09918	0.828	0.733	1.993E-15	251	0.205	0.179	Q09918.pdb.gz	HSP35_SCHPO Putative glutathione-independent glyoxalase hsp3105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp3105 PE=3 SV=1
3	AFDB:Q2UC87	0.764	0.335	6.382E-15	519	0.218	0.092	Q2UC87.pdb.gz	Q2UC87_ASPOR ThiJ/PfpI domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090012000695 PE=4 SV=1
4	AFDB:Q6FX51	0.830	0.777	2.610E-14	236	0.182	0.169	Q6FX51.pdb.gz	Q6FX51_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HSP31 PE=4 SV=1
5	AFDB:Q04432	0.828	0.772	3.137E-14	237	0.205	0.190	Q04432.pdb.gz	HSP31_YEAST Glutathione-independent glyoxalase HSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP31 PE=1 SV=1
6	PDB:1qvvB	0.835	0.778	1.299E-13	237	0.195	0.181	1qvvB.pdb.gz
7	AFDB:Q5AF03	0.826	0.774	2.226E-13	236	0.191	0.178	Q5AF03.pdb.gz	HSP31_CANAL Glyoxalase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GLX3 PE=1 SV=1
8	AFDB:Q09675	0.833	0.768	3.864E-13	240	0.186	0.171	Q09675.pdb.gz	HSP32_SCHPO Glutathione-independent glyoxalase hsp3102 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp3102 PE=1 SV=1
9	PDB:4lruA	0.820	0.759	4.420E-13	239	0.191	0.176	4lruA.pdb.gz
10	PDB:1n57A	0.767	0.618	6.003E-13	279	0.218	0.172	1n57A.pdb.gz
11	AFDB:O74914	0.823	0.749	7.128E-13	244	0.223	0.201	O74914.pdb.gz	HSP31_SCHPO Glutathione-independent glyoxalase hsp3101 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp3101 PE=1 SV=1
12	PDB:3kklB	0.773	0.787	1.415E-12	216	0.186	0.190	3kklB.pdb.gz
13	AFDB:Q04902	0.832	0.776	2.146E-12	237	0.177	0.165	Q04902.pdb.gz	SNO4_YEAST Probable glutathione-independent glyoxalase SNO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNO4 PE=3 SV=1
14	PDB:3miiB	0.822	0.773	3.546E-12	235	0.168	0.157	3miiB.pdb.gz
15	AFDB:P31658	0.780	0.619	7.767E-12	283	0.195	0.152	P31658.pdb.gz	HCHA_ECOLI Protein/nucleic acid deglycase 1 OS=Escherichia coli (strain K12) OX=83333 GN=hchA PE=1 SV=3
16	PDB:3uk7C	0.592	0.346	4.588E-9	396	0.173	0.096	3uk7C.pdb.gz
17	PDB:1oy1A	0.601	0.599	5.514E-9	221	0.191	0.190	1oy1A.pdb.gz
18	PDB:1pdwG	0.578	0.659	1.382E-8	191	0.109	0.126	1pdwG.pdb.gz
19	PDB:4e08A	0.608	0.707	1.924E-7	186	0.136	0.161	4e08A.pdb.gz
20	PDB:4ge3A	0.630	0.715	2.613E-7	191	0.127	0.147	4ge3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NB37	1.03e-162	449	220	1.000	1.000	GALD1_HUMAN Glutamine amidotransferase-like class 1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GATD1 PE=1 SV=1
2	Q2UC87	0.013	38.5	519	0.150	0.064	Q2UC87_ASPOR ThiJ/PfpI domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090012000695 PE=4 SV=1
3	Q09918	0.083	35.8	251	0.168	0.147	HSP35_SCHPO Putative glutathione-independent glyoxalase hsp3105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp3105 PE=3 SV=1
4	Q6T5E0	0.21	34.7	400	0.091	0.050	Q6T5E0_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=4 SV=1
5	Q6T5E1	0.21	34.7	400	0.091	0.050	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
6	Q6T5D9	0.22	34.7	400	0.091	0.050	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
7	Q9M8R4	0.29	34.3	388	0.236	0.134	DJ1D_ARATH Protein DJ-1 homolog D OS=Arabidopsis thaliana OX=3702 GN=DJ1D PE=1 SV=1
8	Q14548	0.33	33.5	182	0.127	0.154	Q14548_HUMAN HOX2.8 protein (Fragment) OS=Homo sapiens OX=9606 GN=HOX2.8 PE=2 SV=1
9	Q7BR72	0.59	32.3	151	0.141	0.205	Q7BR72_STRCO Fe regulatory protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=furA PE=3 SV=1
10	P97402	0.82	32.7	401	0.086	0.047	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
11	Q8N0V5	2.2	31.6	402	0.082	0.045	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
12	Q581Z1	2.4	31.6	394	0.118	0.066	Q581Z1_TRYB2 Acetylornithine deacetylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.370 PE=4 SV=1
13	P0A8C4	2.8	30.8	192	0.100	0.115	YGFB_ECOLI UPF0149 protein YgfB OS=Escherichia coli (strain K12) OX=83333 GN=ygfB PE=3 SV=1
14	P31658	2.9	31.2	283	0.141	0.110	HCHA_ECOLI Protein/nucleic acid deglycase 1 OS=Escherichia coli (strain K12) OX=83333 GN=hchA PE=1 SV=3
15	P14652	4.3	30.8	356	0.077	0.048	HXB2_HUMAN Homeobox protein Hox-B2 OS=Homo sapiens OX=9606 GN=HOXB2 PE=1 SV=1
16	O13963	5.0	30.4	393	0.105	0.059	MVD1_SCHPO Diphosphomevalonate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mvd1 PE=3 SV=1
17	Q38D26	5.1	30.4	788	0.077	0.022	Q38D26_TRYB2 Mismatch repair protein PMS1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4840 PE=3 SV=1
18	Q9BLY2	5.1	30.4	788	0.077	0.022	Q9BLY2_9TRYP Putative mismatch repair protein PMS1 OS=Trypanosoma brucei OX=5691 GN=PMS1 PE=3 SV=1
19	Q57XT2	5.2	30.4	810	0.109	0.030	Q57XT2_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.240 PE=3 SV=1
20	Q9R1I1	7.2	30.0	388	0.064	0.036	CHST4_MOUSE Carbohydrate sulfotransferase 4 OS=Mus musculus OX=10090 GN=Chst4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01965 DJ-1_PfpI	7.7	17.8	DJ-1/PfpI family
2	PF17124 ThiJ_like	2.3e+02	13.0	ThiJ/PfpI family-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351118	0.770	Cadherin-related family member 5
2	9606.ENSP00000435585	0.769	Epidermal growth factor receptor kinase substrate 8-like protein 2
3	9606.ENSP00000371846	0.710	Deformed epidermal autoregulatory factor 1 homolog
4	9606.ENSP00000393066	0.682	Sodium-driven chloride bicarbonate exchanger
5	9606.ENSP00000360195	0.657	KN motif and ankyrin repeat domain-containing protein 4
6	9606.ENSP00000384474	0.639	Huntingtin-interacting protein K
7	9606.ENSP00000351137	0.545	Pre-mRNA-splicing factor SYF1
8	9606.ENSP00000176183	0.544	Dopamine receptor D4
9	9606.ENSP00000331727	0.510	Potassium voltage-gated channel subfamily H member 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.996	catalytic activity
GO:0019172	0.468	glyoxalase III activity
GO:0097159	0.330	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0065007	0.933	biological regulation
GO:0050794	0.877	regulation of cellular process
GO:0008152	0.537	metabolic process
GO:0050896	0.493	response to stimulus
GO:0071704	0.444	organic substance metabolic process
GO:0006807	0.383	nitrogen compound metabolic process
GO:0071840	0.371	cellular component organization or biogenesis
GO:0032501	0.352	multicellular organismal process
GO:0044238	0.350	primary metabolic process
GO:0016043	0.347	cellular component organization
GO:0048518	0.324	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.995	extracellular exosome
GO:0016020	0.916	membrane
GO:0005622	0.915	intracellular anatomical structure
GO:0005737	0.870	cytoplasm
GO:0043229	0.793	intracellular organelle
GO:0043231	0.739	intracellular membrane-bounded organelle
GO:0071944	0.497	cell periphery
GO:0005886	0.451	plasma membrane
GO:0012505	0.364	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:27754	0.468	H2O + methylglyoxal = (R)-lactate + H(+)
EC:4.2.1.130	0.468	D-lactate dehydratase.

[back to server]