StarFunc result for job id Q8NB46

User Input

>input (1076 residues)
MGILSITDQPPLVQAIFSRDVEEVRSLLSQKENINVLDQERRTPLHAAAYVGDVPILQLL
LMSGANVNAKDTLWLTPLHRAAASRNEKVLGLLLAHSADVNARDKLWQTPLHVAAANRAT
KCAEALAPLLSSLNVADRSGRSALHHAVHSGHLETVNLLLNKGASLNVCDKKERQPLHWA
AFLGHLEVLKLLVARGADLGCKDRKGYGLLHTAAASGQIEVVKYLLRMGAEIDEPNAFGN
TALHIACYLGQDAVAIELVNAGANVNQPNDKGFTPLHVAAVSTNGALCLELLVNNGADVN
YQSKEGKSPLHMAAIHGRFTRSQILIQNGSEIDCADKFGNTPLHVAARYGHELLISTLMT
NGADTARRGIHDMFPLHLAVLFGFSDCCRKLLSSGQLYSIVSSLSNEHVLSAGFDINTPD
NLGRTCLHAAASGGNVECLNLLLSSGADLRRRDKFGRTPLHYAAANGSYQCAVTLVTAGA
GVNEADCKGCSPLHYAAASDTYRRAEPHTPSSHDAEEDEPLKESRRKEAFFCLEFLLDNG
ADPSLRDRQGYTAVHYAAAYGNRQNLELLLEMSFNCLEDVESTIPVSPLHLAAYNGHCEA
LKTLAETLVNLDVRDHKGRTALFLATERGSTECVEVLTAHGASALIKERKRKWTPLHAAA
ASGHTDSLHLLIDSGERADITDVMDAYGQTPLMLAIMNGHVDCVHLLLEKGSTADAADLR
GRTALHRGAVTGCEDCLAALLDHDAFVLCRDFKGRTPIHLASACGHTAVLRTLLQAALST
DPLDAGVDYSGYSPMHWASYTGHEDCLELLLEHSPFSYLEGNPFTPLHCAVINNQDSTTE
MLLGALGAKIVNSRDAKGRTPLHAAAFADNVSGLRMLLQHQAEVNATDHTGRTALMTAAE
NGQTAAVEFLLYRGKADLTVLDENKNTALHLACSKGHEKCALMILAETQDLGLINATNSA
LQMPLHIAARNGLASVVQALLSHGATVLAVDEEGHTPALACAPNKDVADCLALILSTMKP
FPPKDAVSPFSFSLLKNCSIAAAKTVGGCGALPHGASCPYSQERPGAIGLDGCYSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NB46	1.000	1.000	0.000	1076	1.000	1.000	Q8NB46.pdb.gz	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
2	AFDB:O15084	0.733	0.747	3.414E-97	1053	0.586	0.599	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
3	AFDB:Q8N8A2	0.657	0.708	1.270E-94	993	0.574	0.622	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
4	AFDB:Q9VMR4	0.517	0.335	6.714E-46	1761	0.256	0.156	Q9VMR4.pdb.gz	Q9VMR4_DROME No mechanoreceptor potential C, isoform H OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=4
5	AFDB:A0A0G2K916	0.613	0.280	2.233E-42	2615	0.248	0.102	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
6	AFDB:O75179	0.701	0.301	2.707E-42	2603	0.266	0.110	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
7	AFDB:Q9NCP8	0.385	0.360	5.006E-42	1159	0.229	0.212	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	AFDB:Q0KIE7	0.390	0.279	7.352E-42	1549	0.219	0.152	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
9	AFDB:P16157	0.422	0.258	8.250E-42	1881	0.243	0.139	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
10	AFDB:G5E8K5	0.361	0.210	9.998E-42	1961	0.226	0.124	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
11	PDB:8cs9A	0.356	0.465	4.686E-41	796	0.217	0.294	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.415	0.314	1.895E-36	1499	0.233	0.167	5vkqA.pdb.gz
13	PDB:4oauC	0.237	0.359	1.403E-12	692	0.081	0.126	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.170	0.621	4.474E-10	229	0.060	0.284	2dvwA.pdb.gz
15	PDB:1wg0A	0.193	0.815	1.174E-8	243	0.059	0.259	1wg0A.pdb.gz
16	PDB:6aunA	0.218	0.364	2.531E-8	618	0.086	0.149	6aunA.pdb.gz
17	PDB:6v9hC	0.199	0.761	3.442E-8	270	0.059	0.237	6v9hC.pdb.gz
18	PDB:6jd6B	0.151	0.786	1.602E-7	192	0.050	0.281	6jd6B.pdb.gz
19	PDB:6pqpA	0.172	0.287	2.962E-7	615	0.108	0.189	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6mwqA	0.143	0.302	5.479E-7	493	0.101	0.221	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15084	0.0	1236	1053	0.587	0.600	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
2	Q8N8A2	0.0	1228	993	0.569	0.616	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
3	Q8NB46	0.0	2195	1076	1.000	1.000	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
4	X2JCM1	1.89e-81	295	11634	0.238	0.022	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
5	M9MRX4	7.49e-81	293	13559	0.238	0.019	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	M9MSK6	7.65e-80	290	4352	0.240	0.059	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	M9MS19	1.14e-79	289	4230	0.240	0.061	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	A8JNM7	1.67e-79	289	4114	0.238	0.062	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	M9MRR4	1.75e-79	289	4223	0.238	0.061	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	Q7KU92	1.79e-79	288	4083	0.238	0.063	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
11	A8JNM6	1.88e-79	288	4189	0.238	0.061	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	M9MRX1	1.89e-79	288	4329	0.238	0.059	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	A0A5F9ZH19	3.55e-79	288	3895	0.245	0.068	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	Q17490	8.29e-79	287	6994	0.239	0.037	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
15	X2JC49	1.68e-78	286	4233	0.236	0.060	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	M9PEN3	1.70e-78	286	4373	0.236	0.058	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	A0A5F9ZHF7	1.84e-78	285	3862	0.241	0.067	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	M9MRS5	1.86e-78	285	4496	0.236	0.056	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	A8JNM5	1.88e-78	285	4264	0.236	0.060	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	F1M5N3	2.61e-77	282	3966	0.243	0.066	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.7e-117	390.0	Ankyrin repeat
2	PF12796 Ank_2	2.5e-147	491.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.6e-107	347.2	Ankyrin repeat
4	PF13637 Ank_4	5.7e-141	468.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1e-100	339.8	Ankyrin repeats (many copies)
6	PF13537 GATase_7	7	18.0	Glutamine amidotransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267116

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392147	0.916	Protein phosphatase 6 catalytic subunit
2	9606.ENSP00000478417	0.872	Serine/threonine-protein phosphatase 6 regulatory subunit 2
3	9606.ENSP00000329466	0.802	NAD-dependent protein deacetylase sirtuin-7
4	9606.ENSP00000414202	0.780	Serine/threonine-protein phosphatase 6 regulatory subunit 1
5	9606.ENSP00000404151	0.746	Centrosomal protein of 170 kDa protein B
6	9606.ENSP00000238823	0.719	Protein FAM98A
7	9606.ENSP00000225174	0.710	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
8	9606.ENSP00000262102	0.676	Microtubule-associated tumor suppressor 1
9	9606.ENSP00000465517	0.654	UPF0711 protein C18orf21
10	9606.ENSP00000217964	0.653	F-box-like/WD repeat-containing protein TBL1X
11	9606.ENSP00000405574	0.653	F-box-like/WD repeat-containing protein TBL1XR1
12	9606.ENSP00000261868	0.629	Eukaryotic translation initiation factor 3 subunit J
13	9606.ENSP00000381984	0.623	Regulation of nuclear pre-mRNA domain-containing protein 1A
14	9606.ENSP00000342755	0.619	E3 ubiquitin-protein ligase NRDP1
15	9606.ENSP00000260803	0.609	Lariat debranching enzyme
16	9606.ENSP00000378275	0.607	Polyadenylate-binding protein-interacting protein 2
17	9606.ENSP00000228515	0.599	Cysteine/serine-rich nuclear protein 2
18	9606.ENSP00000300101	0.579	Zinc finger and BTB domain-containing protein 39
19	9606.ENSP00000384018	0.572	Nuclear receptor corepressor 2
20	9606.ENSP00000312379	0.560	Histone-lysine N-methyltransferase 2E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.365	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.814	biological regulation
GO:0050789	0.687	regulation of biological process
GO:0050794	0.588	regulation of cellular process
GO:0008152	0.398	metabolic process
GO:0050896	0.393	response to stimulus
GO:0071704	0.376	organic substance metabolic process
GO:0032501	0.370	multicellular organismal process
GO:0006807	0.337	nitrogen compound metabolic process
GO:0044238	0.316	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.963	cytosol
GO:0005634	0.955	nucleus
GO:0070013	0.950	intracellular organelle lumen
GO:0031981	0.889	nuclear lumen
GO:0005654	0.872	nucleoplasm
GO:0016020	0.397	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]