StarFunc result for job id Q8NB49

User Input

>input (1132 residues)
MQMVPSLPPASECAGEEKRVGTRTVFVGNHPVSETEAYIAQRFCDNRIVSSKYTLWNFLP
KNLFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVTAIKQGYEDCLRHRAD
NEVNKSTVYIIENAKRVRKESEKIKVGDVVEVQADETFPCDLILLSSCTTDGTCYVTTAS
LDGESNCKTHYAVRDTIALCTAESIDTLRAAIECEQPQPDLYKFVGRINIYSNSLEAVAR
SLGPENLLLKGATLKNTEKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLF
ILLTKAAVCTTLKYVWQSTPYNDEPWYNQKTQKERETLKVLKMFTDFLSFMVLFNFIIPV
SMYVTVEMQKFLGSFFISWDKDFYDEEINEGALVNTSDLNEELGQVDYVFTDKTGTLTEN
SMEFIECCIDGHKYKGVTQEVDGLSQTDGTLTYFDKVDKNREELFLRALCLCHTVEIKTN
DAVDGATESAELTYISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHT
LNFDAVRRRMSVIVKTQEGDILLFCKGADSAVFPRVQNHEIELTKVHVERNAMDGYRTLC
VAFKEIAPDDYERINRQLIEAKMALQDREEKMEKVFDDIETNMNLIGATAVEDKLQDQAA
ETIEALHAAGLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLHE
LLIEYRKKLLHEFPKSTRSFKKAWTEHQEYGLIIDGSTLSLILNSSQDSSSNNYKSIFLQ
ICMKCTAVLCCRMAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVGIGIKGKE
GRQAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGF
SQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINIDTLTSDPRLYMKISGNAMLQLGPFL
YWTFLAAFEGTVFFFGTYFLFQTASLEENGKVYGNWTFGTIVFTVLVFTVTLKLALDTRF
WTWINHFVIWGSLAFYVFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFIS
LFPEILLIVLKNVRRRSARRNLSCRRASDSLSARPSVRPLLLRTFSDESNVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6lknA	0.877	0.931	0.000	1064	0.937	0.997	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
2	PDB:7bspA	0.705	0.767	0.000	1028	0.904	0.995	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
3	AFDB:E9PEJ6	0.853	0.813	0.000	1191	0.636	0.605	E9PEJ6.pdb.gz	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
4	AFDB:Q8NB49	1.000	1.000	0.000	1132	1.000	1.000	Q8NB49.pdb.gz	AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens OX=9606 GN=ATP11C PE=1 SV=3
5	AFDB:Q9Y2G3	0.898	0.864	0.000	1177	0.542	0.521	Q9Y2G3.pdb.gz	AT11B_HUMAN Phospholipid-transporting ATPase IF OS=Homo sapiens OX=9606 GN=ATP11B PE=1 SV=2
6	PDB:7bssA	0.621	0.837	1.459E-101	816	0.711	0.987	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
7	AFDB:P70704	0.859	0.836	7.209E-97	1164	0.349	0.339	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
8	AFDB:Q9XIE6	0.843	0.789	1.262E-96	1213	0.356	0.332	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
9	AFDB:Q9SAF5	0.868	0.818	6.470E-96	1203	0.341	0.321	Q9SAF5.pdb.gz	ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana OX=3702 GN=ALA11 PE=2 SV=1
10	AFDB:Q9LNQ4	0.876	0.818	2.178E-95	1216	0.332	0.309	Q9LNQ4.pdb.gz	ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana OX=3702 GN=ALA4 PE=3 SV=2
11	AFDB:Q9SLK6	0.872	0.798	3.316E-95	1240	0.339	0.310	Q9SLK6.pdb.gz	ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana OX=3702 GN=ALA6 PE=1 SV=2
12	AFDB:Q8TF62	0.868	0.825	4.818E-95	1192	0.336	0.319	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
13	AFDB:F4IE35	0.833	0.798	9.705E-95	1185	0.342	0.327	F4IE35.pdb.gz	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
14	PDB:7kycA	0.848	0.816	2.083E-84	1178	0.316	0.304	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:6rohA	0.834	0.849	2.396E-84	1112	0.336	0.342	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
16	PDB:7kyaA	0.859	0.829	2.292E-81	1174	0.307	0.296	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
17	PDB:7py4A	0.834	0.848	2.516E-81	1112	0.313	0.318	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
18	PDB:7vghB	0.847	0.812	1.157E-79	1183	0.318	0.304	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
19	PDB:6k7lA	0.798	0.907	1.296E-74	992	0.331	0.378	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
20	PDB:7rd6A	0.750	0.908	6.276E-67	929	0.246	0.299	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW70	629	1190	0.329	0.313	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
2	A0A8I5ZKC1	567	985	0.297	0.341	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
3	A0A8I5ZXX6	669	1164	0.351	0.341	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
4	A0A8I6AVY6	670	1164	0.350	0.340	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
5	A0A8I6G2I8	567	978	0.297	0.344	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A3FIN4	603	1183	0.341	0.326	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
7	C7EXK4	627	1148	0.363	0.358	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
8	D4A3X6	636	1169	0.358	0.346	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
9	D4AA47	595	1251	0.324	0.293	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
10	E9PEJ6	1498	1191	0.633	0.601	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
11	F1LUT4	569	984	0.299	0.343	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
12	F4IE35	660	1185	0.353	0.338	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
13	H0Y547	1276	935	0.545	0.660	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
14	O43520	591	1251	0.324	0.293	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
15	O94296	609	1258	0.322	0.290	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
16	P39524	618	1355	0.340	0.284	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
17	P70704	672	1164	0.351	0.341	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
18	P98196	1500	1134	0.633	0.631	AT11A_HUMAN Phospholipid-transporting ATPase IH OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=3
19	P98197	1475	1187	0.625	0.596	AT11A_MOUSE Phospholipid-transporting ATPase IH OS=Mus musculus OX=10090 GN=Atp11a PE=1 SV=1
20	P98198	629	1209	0.329	0.308	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18876 AF-4_C	1.7e+02	13.0	AF-4 proto-oncoprotein C-terminal region
2	PF13246 Cation_ATPase	2.7e-07	41.9	Cation transport ATPase (P-type)
3	PF00122 E1-E2_ATPase	2.5e-07	41.9	E1-E2 ATPase
4	PF00702 Hydrolase	7.4e-06	37.9	haloacid dehalogenase-like hydrolase
5	PF08282 Hydrolase_3	79	14.4	haloacid dehalogenase-like hydrolase
6	PF16212 PhoLip_ATPase_C	2.7e-69	245.3	Phospholipid-translocating P-type ATPase C-terminal
7	PF16209 PhoLip_ATPase_N	1.6e-18	77.5	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332756

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.973	Cell cycle control protein 50A
2	9606.ENSP00000311837	0.845	Gamma-2-syntrophin
3	9606.ENSP00000362991	0.841	XK-related protein 8
4	9606.ENSP00000450842	0.761	Cell cycle control protein 50B
5	9606.ENSP00000419663	0.751	Cell cycle control protein 50C
6	9606.ENSP00000359567	0.720	Transcription factor SOX-3
7	9606.ENSP00000218099	0.697	Coagulation factor IX
8	9606.ENSP00000318086	0.675	MAP7 domain-containing protein 3
9	9606.ENSP00000245838	0.664	THO complex subunit 2
10	9606.ENSP00000386141	0.649	XK-related protein 9
11	9606.ENSP00000321348	0.642	Protein diaphanous homolog 2
12	9606.ENSP00000362372	0.639	Bromodomain and WD repeat-containing protein 3
13	9606.ENSP00000349877	0.600	Manganese-transporting ATPase 13A1
14	9606.ENSP00000409126	0.592	Anoctamin-6
15	9606.ENSP00000262844	0.581	AMME syndrome candidate gene 1 protein
16	9606.ENSP00000335094	0.581	Transmembrane protein 17
17	9606.ENSP00000365351	0.573	Integrin subunit beta like 1
18	9606.ENSP00000403954	0.560	Teneurin-1
19	9606.ENSP00000325929	0.538	Ligand of numb-protein X 2
20	9606.ENSP00000379838	0.529	Calcium-regulated heat-stable protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140333	0.995	glycerophospholipid flippase activity
GO:0015247	0.407	aminophospholipid flippase activity
GO:0140346	0.401	phosphatidylserine flippase activity
GO:0090555	0.380	phosphatidylethanolamine flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.984	biological regulation
GO:0097035	0.964	regulation of membrane lipid distribution
GO:0051179	0.885	localization
GO:0015914	0.856	phospholipid transport
GO:0034204	0.763	lipid translocation
GO:0050789	0.637	regulation of biological process
GO:0050794	0.559	regulation of cellular process
GO:0045332	0.503	phospholipid translocation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0016020	0.997	membrane
GO:0005886	0.965	plasma membrane
GO:0032991	0.956	protein-containing complex
GO:1990531	0.909	phospholipid-translocating ATPase complex
GO:0031090	0.792	organelle membrane
GO:0031982	0.745	vesicle
GO:0098588	0.637	bounding membrane of organelle
GO:0005783	0.637	endoplasmic reticulum
GO:0031410	0.317	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.
RHEA:66132	0.380	a 1,2-diacyl-sn-glycero-3-phosphoethanolamine(out) + ATP + H2O = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine(in) + ADP + H(+) + phosphate

[back to server]