StarFunc result for job id Q8NB66

User Input

>input (2214 residues)
MVANFFKSLILPYIHKLCKGMFTKKLGNTNKNKEYRQQKKDQDFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTEEDEASKEFSLSPTFSYRVAIANGLQKNAKVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVTEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMAIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLSKSELLTKGSTS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDS
PKDQHLNGGVQGIQGQTETENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEW
NQGADLGLDSSTQEGFDYETNSLFDQQLDVYNKDLEYLGKCHSDLQDDSESYDLTQDDNS
SPCPGLDNEPQGQWVGQYDSYQGANSNELYQNQNQLSMMYRSQSELQSDDSEDAPPKSWH
SRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQST
ANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITETDE
QMQAYDHLSYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPEQPV
EITKPKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSALQ
VCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHV
FKKTLQALIYPMSSTIPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQ
DLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKEDF
VQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIF
GNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLS
GEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSN
GGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVPAV
MSTLLANINAFYAHTTVSTNIQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYREN
FPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIFDN
CHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQE
LNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKD
AVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSEHALFSCSVVDVFAQL
NQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSHCDKENVPCILMNN
IQQLRVQLEKMFESMGGKELDSEASTILKELQVKLSGVLDELSVTYGESFQVIIEECIKQ
MSFELNQMRANGNTTSNKNSAAMDAEIVLRSLMDFLDKTLSLSAKICEKTVLKRVLKELW
KLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDARGLTPRQCAIMEV
VLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRSSK
DAVGQISVHVDITATPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKKRK
QGTKTKSNTWSPKYNETFQFILGKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIA
EKGSYGAWYPLLKNISMDETGLTILRILSQRTSDDVAKEFVRLKSETRSTEESA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27715	0.497	0.510	0.000	2155	0.357	0.367	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
2	AFDB:Q8NB66	1.000	1.000	0.000	2214	1.000	1.000	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
3	PDB:1cjyA	0.051	0.170	2.503E-7	633	0.021	0.074	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
4	AFDB:P41885	0.041	0.079	1.764E-6	1106	0.074	0.147	P41885.pdb.gz	RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans OX=6239 GN=rbf-1 PE=2 SV=2
5	PDB:3pfqA	0.053	0.213	2.812E-6	523	0.013	0.055	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
6	PDB:5a50A	0.052	0.561	3.452E-6	165	0.016	0.212	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
7	PDB:3nsjA	0.048	0.193	1.134E-5	530	0.015	0.062	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
8	PDB:5ixcA	0.048	0.152	1.134E-5	684	0.012	0.038	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
9	PDB:5a52A	0.048	0.581	1.282E-5	154	0.014	0.195	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
10	PDB:4rj9A	0.048	0.585	1.574E-5	161	0.014	0.193	4rj9A.pdb.gz
11	PDB:5izrC	0.048	0.155	2.276E-5	659	0.012	0.039	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:5iz5B	0.050	0.144	3.574E-5	746	0.012	0.036	5iz5B.pdb.gz
13	PDB:5iz5A	0.047	0.133	4.762E-5	757	0.011	0.033	5iz5A.pdb.gz
14	AFDB:Q9W517	0.061	0.071	4.293E-4	1741	0.090	0.114	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
15	AFDB:A0A1D8PFH4	0.034	0.045	1.879E-3	1466	0.076	0.115	A0A1D8PFH4.pdb.gz	A0A1D8PFH4_CANAL Spa2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPA2 PE=4 SV=1
16	AFDB:Q54KI4	0.023	0.037	2.214E-3	1196	0.064	0.118	Q54KI4.pdb.gz	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
17	AFDB:E5FYH1	0.071	0.086	2.608E-3	1653	0.099	0.133	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
18	AFDB:Q99NE5	0.041	0.059	2.717E-3	1463	0.084	0.128	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
19	AFDB:Q9VTS9	0.064	0.070	6.428E-3	1900	0.117	0.136	Q9VTS9.pdb.gz	Q9VTS9_DROME Rolling pebbles, isoform B OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=2
20	AFDB:O77086	0.044	0.055	8.222E-3	1571	0.091	0.129	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	G5EDN9	1409	1819	0.311	0.379	G5EDN9_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=1
2	H9XVP2	1654	3186	0.355	0.246	H9XVP2_DROME Unc-13, isoform E OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
3	L0MPR2	1325	2711	0.309	0.253	L0MPR2_DROME Unc-13, isoform F OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
4	O14795	1934	1591	0.403	0.561	UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2
5	O96959	1608	1304	0.349	0.592	O96959_DROME UNC-13 protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
6	O96960	1615	1724	0.348	0.447	O96960_DROME UNC-13-B protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
7	P27715	1411	2155	0.309	0.318	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
8	Q4KUS2	1895	1712	0.401	0.518	UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3
9	Q62768	1878	1735	0.400	0.510	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
10	Q62769	1922	1622	0.404	0.552	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
11	Q62770	4068	2204	0.906	0.910	UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus OX=10116 GN=Unc13c PE=1 SV=3
12	Q8IM86	1658	3183	0.354	0.246	Q8IM86_DROME Unc-13, isoform B OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
13	Q8IM87	1643	2871	0.351	0.271	Q8IM87_DROME Unc-13, isoform A OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
14	Q8K0T7	4103	2210	0.910	0.911	UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus OX=10090 GN=Unc13c PE=1 SV=3
15	Q8NB66	4620	2214	1.000	1.000	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
16	Q8T049	1630	1508	0.351	0.515	Q8T049_DROME LD28927p OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
17	Q9U4K9	1598	1752	0.348	0.440	Q9U4K9_DROME UNC-13 OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
18	Q9UPW8	1902	1703	0.402	0.523	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
19	Q9V483	1654	2874	0.355	0.274	Q9V483_DROME Unc-13, isoform C OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=4
20	Q9Z1N9	1931	1602	0.404	0.559	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	2e-07	42.1	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00168 C2	1.1e-40	149.5	C2 domain
3	PF10224 DUF2205	1.7e+02	13.8	Short coiled-coil protein
4	PF06292 MUN	5.1e-149	508.4	MUN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260323

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429562	0.835	Protein unc-13 homolog A
2	9606.ENSP00000367756	0.828	Protein unc-13 homolog B
3	9606.ENSP00000362399	0.703	Syntaxin-binding protein 1
4	9606.ENSP00000428417	0.689	Regulating synaptic membrane exocytosis protein 1
5	9606.ENSP00000261655	0.664	RIMS-binding protein 2
6	9606.ENSP00000364979	0.651	Collagen alpha-1(IV) chain
7	9606.ENSP00000413156	0.647	Ras-related protein Rab-34
8	9606.ENSP00000261205	0.622	Synaptotagmin-1
9	9606.ENSP00000215095	0.604	Syntaxin-1B
10	9606.ENSP00000334319	0.595	Protein piccolo
11	9606.ENSP00000356236	0.593	Synaptotagmin-2
12	9606.ENSP00000254976	0.581	Synaptosomal-associated protein 25
13	9606.ENSP00000345824	0.564	Benzodiazepine receptor (peripheral) associated protein 1
14	9606.ENSP00000373215	0.563	Calcium-dependent secretion activator 1
15	9606.ENSP00000222812	0.561	Syntaxin-1A
16	9606.ENSP00000353362	0.554	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
17	9606.ENSP00000351569	0.549	Small integral membrane protein 7
18	9606.ENSP00000468263	0.530	ELKS/Rab6-interacting/CAST family member 1
19	9606.ENSP00000296658	0.523	Carboxymethylenebutenolidase homolog
20	9606.ENSP00000302485	0.522	Cold shock domain-containing protein C2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.990	molecular transducer activity
GO:0005516	0.909	calmodulin binding
GO:0038023	0.784	signaling receptor activity
GO:0000149	0.685	SNARE binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.997	biological regulation
GO:0099177	0.994	regulation of trans-synaptic signaling
GO:0045055	0.991	regulated exocytosis
GO:0001505	0.988	regulation of neurotransmitter levels
GO:0006836	0.988	neurotransmitter transport
GO:0099643	0.987	signal release from synapse
GO:0007268	0.985	chemical synaptic transmission
GO:0016079	0.979	synaptic vesicle exocytosis
GO:0050804	0.965	modulation of chemical synaptic transmission
GO:0071840	0.441	cellular component organization or biogenesis
GO:0016043	0.390	cellular component organization
GO:0032879	0.305	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098793	0.999	presynapse
GO:0016020	0.982	membrane
GO:0005737	0.978	cytoplasm
GO:0043227	0.977	membrane-bounded organelle
GO:0071944	0.971	cell periphery
GO:0012505	0.964	endomembrane system
GO:0005886	0.964	plasma membrane
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0031982	0.814	vesicle
GO:0042995	0.795	cell projection
GO:0031410	0.794	cytoplasmic vesicle
GO:0048786	0.724	presynaptic active zone
GO:0099503	0.685	secretory vesicle
GO:0030424	0.637	axon
GO:0012506	0.454	vesicle membrane
GO:0030659	0.425	cytoplasmic vesicle membrane
GO:0043679	0.356	axon terminus
GO:0098588	0.330	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]