StarFunc result for job id Q8NB78

User Input

>input (822 residues)
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPE
TSDHCSLPEDLRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRA
AATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEY
SRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKG
LINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGR
VWDDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTID
KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHL
SNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQC
IDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIE
KIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVAS
VRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYD
IIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7xe1A	0.905	0.990	0.000	751	0.912	0.999	7xe1A.pdb.gz	Structure-Activity Relationship and In Silico Evaluation of cis- and trans-PCPA-Derived Inhibitors of LSD1 and LSD2
2	AFDB:H0Y6H0	0.951	0.950	0.000	823	0.999	0.998	H0Y6H0.pdb.gz	H0Y6H0_HUMAN Lysine demethylase 1B OS=Homo sapiens OX=9606 GN=KDM1B PE=1 SV=2
3	AFDB:Q8CIG3	0.949	0.945	0.000	826	0.899	0.895	Q8CIG3.pdb.gz	KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus OX=10090 GN=Kdm1b PE=1 SV=1
4	AFDB:Q21988	0.818	0.816	1.330E-68	824	0.321	0.320	Q21988.pdb.gz	KDM1B_CAEEL Lysine-specific histone demethylase 1B homolog OS=Caenorhabditis elegans OX=6239 GN=amx-1 PE=1 SV=3
5	AFDB:Q9LID0	0.604	0.663	1.019E-52	746	0.232	0.256	Q9LID0.pdb.gz	LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=LDL2 PE=1 SV=1
6	AFDB:Q8VXV7	0.594	0.579	5.163E-52	844	0.226	0.220	Q8VXV7.pdb.gz	LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=LDL1 PE=1 SV=1
7	AFDB:Q9CAE3	0.581	0.605	1.478E-50	789	0.223	0.232	Q9CAE3.pdb.gz	FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana OX=3702 GN=FLD PE=1 SV=1
8	AFDB:A0A2R8Q8P2	0.594	0.569	3.307E-48	858	0.235	0.225	A0A2R8Q8P2.pdb.gz
9	AFDB:R4GMQ1	0.590	0.566	3.685E-48	858	0.234	0.224	R4GMQ1.pdb.gz	R4GMQ1_HUMAN Lysine-specific histone demethylase OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2
10	AFDB:A0A0G2K736	0.600	0.571	1.148E-47	865	0.273	0.259	A0A0G2K736.pdb.gz	A0A0G2K736_RAT Lysine-specific histone demethylase OS=Rattus norvegicus OX=10116 GN=Kdm1a PE=1 SV=2
11	PDB:6tuyA	0.582	0.713	1.092E-46	667	0.242	0.298	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
12	AFDB:Q9VW97	0.593	0.549	7.399E-46	890	0.236	0.218	Q9VW97.pdb.gz	LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster OX=7227 GN=Su(var)3-3 PE=1 SV=1
13	PDB:5mbxA	0.479	0.815	3.255E-32	472	0.153	0.267	5mbxA.pdb.gz	The Structure of Murine N(1)-Acetylspermine Oxidase Reveals Molecular Details of Vertebrate Polyamine Catabolism.
14	PDB:3kpfA	0.465	0.789	4.266E-32	467	0.144	0.253	3kpfA.pdb.gz	The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
15	PDB:4gdpB	0.469	0.746	9.202E-27	502	0.129	0.211	4gdpB.pdb.gz	Mechanistic and Structural Analyses of the Roles of Active Site Residues in Yeast Polyamine Oxidase Fms1: Characterization of the N195A and D94N Enzymes.
16	PDB:6fvzA	0.438	0.693	4.419E-26	500	0.122	0.200	6fvzA.pdb.gz	Tight-Binding Inhibition of Human Monoamine Oxidase B by Chromone Analogs: A Kinetic, Crystallographic, and Biological Analysis.
17	PDB:2z5xA	0.432	0.671	1.050E-25	513	0.123	0.197	2z5xA.pdb.gz	Structure of human monoamine oxidase A at 2.2-A resolution: The control of opening the entry for substrates/inhibitors
18	PDB:1o5wC	0.431	0.669	5.323E-25	512	0.124	0.199	1o5wC.pdb.gz	Structure of rat monoamine oxidase a and its specific recognitions for substrates and inhibitors.
19	PDB:1rsgA	0.457	0.757	2.226E-23	481	0.124	0.212	1rsgA.pdb.gz	Crystal structures of fms1 and its complex with spermine reveal substrate specificity.
20	PDB:5ts5A	0.409	0.667	1.155E-21	483	0.107	0.182	5ts5A.pdb.gz	Crystal structure and molecular dynamics studies of L-amino acid oxidase from Bothrops atrox.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y6H0	0.0	1721	823	1.000	0.999	H0Y6H0_HUMAN Lysine demethylase 1B OS=Homo sapiens OX=9606 GN=KDM1B PE=1 SV=2
2	Q8CIG3	0.0	1532	826	0.899	0.895	KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus OX=10090 GN=Kdm1b PE=1 SV=1
3	Q8NB78	0.0	1725	822	1.000	1.000	KDM1B_HUMAN Lysine-specific histone demethylase 2 OS=Homo sapiens OX=9606 GN=KDM1B PE=1 SV=3
4	Q21988	3.97e-131	413	824	0.326	0.325	KDM1B_CAEEL Lysine-specific histone demethylase 1B homolog OS=Caenorhabditis elegans OX=6239 GN=amx-1 PE=1 SV=3
5	Q9CAE3	4.00e-95	317	789	0.224	0.233	FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana OX=3702 GN=FLD PE=1 SV=1
6	Q8VXV7	3.51e-92	310	844	0.230	0.224	LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=LDL1 PE=1 SV=1
7	Q9LID0	3.75e-81	278	746	0.231	0.255	LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=LDL2 PE=1 SV=1
8	Q7XR46	1.12e-57	207	487	0.176	0.298	PAO4_ORYSJ Polyamine oxidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=PAO4 PE=1 SV=1
9	Q8H191	2.35e-57	206	497	0.175	0.290	PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana OX=3702 GN=PAO4 PE=1 SV=1
10	A8K2R3	3.67e-56	208	730	0.150	0.168	A8K2R3_HUMAN cDNA FLJ75083, highly similar to Homo sapiens amine oxidase (flavin containing) domain 2 (AOF2),mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
11	Q6ZQ88	7.76e-56	209	853	0.150	0.144	KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus OX=10090 GN=Kdm1a PE=1 SV=2
12	A0A8I6G2K8	9.20e-56	208	852	0.150	0.144	A0A8I6G2K8_RAT Lysine-specific histone demethylase OS=Rattus norvegicus OX=10116 GN=Kdm1a PE=1 SV=1
13	O60341	1.08e-55	208	852	0.150	0.144	KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2
14	B3STT9	1.29e-55	208	872	0.150	0.141	B3STT9_RAT Lysine-specific histone demethylase OS=Rattus norvegicus OX=10116 GN=Kdm1a PE=1 SV=1
15	A0A0G2K736	1.38e-55	208	876	0.150	0.140	A0A0G2K736_RAT Lysine-specific histone demethylase OS=Rattus norvegicus OX=10116 GN=Kdm1a PE=1 SV=2
16	F6NIA2	1.68e-55	207	833	0.150	0.148	F6NIA2_DANRE Lysine-specific histone demethylase OS=Danio rerio OX=7955 GN=aof2 PE=1 SV=1
17	A0A0P0UQI8	1.74e-55	207	830	0.150	0.148	A0A0P0UQI8_DANRE Lysine-specific histone demethylase OS=Danio rerio OX=7955 GN=lsd1 PE=1 SV=1
18	R4GMQ1	1.75e-55	207	858	0.145	0.139	R4GMQ1_HUMAN Lysine-specific histone demethylase OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2
19	A0JMQ3	2.27e-55	207	848	0.150	0.145	A0JMQ3_DANRE Aof2 protein (Fragment) OS=Danio rerio OX=7955 GN=aof2 PE=2 SV=1
20	Q9LYT1	2.36e-52	192	488	0.163	0.275	PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana OX=3702 GN=PAO3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	11	16.8	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	15	16.3	Alanine dehydrogenase/PNT, C-terminal domain
3	PF01593 Amino_oxidase	2.2e-85	299.3	Flavin containing amine oxidoreductase
4	PF08037 Attractin	2.9e+02	12.9	Attractin family
5	PF01266 DAO	0.012	26.9	FAD dependent oxidoreductase
6	PF00890 FAD_binding_2	0.12	23.1	FAD binding domain
7	PF01494 FAD_binding_3	0.0019	29.2	FAD binding domain
8	PF12831 FAD_oxidored	0.61	20.9	FAD dependent oxidoreductase
9	PF01134 GIDA	1.2	19.8	Glucose inhibited division protein A
10	PF03486 HI0933_like	0.0019	28.6	HI0933-like protein
11	PF07991 IlvN	1.2e+02	13.7	Acetohydroxy acid isomeroreductase, NADPH-binding domain
12	PF05834 Lycopene_cycl	0.075	23.7	Lycopene cyclase protein
13	PF13241 NAD_binding_7	72	15.2	Putative NAD(P)-binding
14	PF13450 NAD_binding_8	1e-08	46.6	NAD(P)-binding Rossmann-like domain
15	PF13454 NAD_binding_9	1.2	20.7	FAD-NAD(P)-binding
16	PF00070 Pyr_redox	0.0022	29.8	Pyridine nucleotide-disulphide oxidoreductase
17	PF07992 Pyr_redox_2	0.00012	33.0	Pyridine nucleotide-disulphide oxidoreductase
18	PF13738 Pyr_redox_3	0.00044	31.2	Pyridine nucleotide-disulphide oxidoreductase
19	PF01488 Shikimate_DH	5.5e+02	12.0	Shikimate / quinate 5-dehydrogenase
20	PF04433 SWIRM	0.0015	30.2	SWIRM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008975029.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.963	Belongs to the histone H2B family.
2	9597.XP_003804484.2	0.950	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
3	9597.XP_003808846.1	0.924	Belongs to the histone H3 family.
4	9597.XP_008958392.1	0.924	Histone H3
5	9597.XP_003815153.2	0.919	Glyoxylate reductase 1 homolog
6	9597.XP_003829732.2	0.918	Histone H3.1-like
7	9597.XP_003829744.2	0.918	Histone H3.1-like
8	9597.XP_008958120.1	0.918	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
9	9597.XP_008959404.1	0.918	Belongs to the MHC class I family.
10	9597.XP_003829743.1	0.917	Belongs to the histone H2A family.
11	9597.XP_003804475.1	0.899	Belongs to the histone H3 family.
12	9597.XP_003804597.1	0.899	Histone H3.1
13	9597.XP_003804825.1	0.899	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 84 Proteins, and 57% coverage of the annotated genomic feature by RNAseq alignments
14	9597.XP_003814967.1	0.899	H3 histone, family 3A
15	9597.XP_003829731.1	0.899	Histone H3.1
16	9597.XP_008958127.1	0.899	Histone H3.1
17	9597.XP_008959258.1	0.899	Histone H3.1-like
18	9597.XP_003813324.1	0.888	Belongs to the histone H3 family.
19	9597.XP_008964555.1	0.888	H3 histone, family 3C
20	9597.XP_008972370.1	0.888	Histone H3.3-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016705	0.999	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0032453	0.999	histone H3K4 demethylase activity
GO:0008270	0.999	zinc ion binding
GO:0050660	0.999	flavin adenine dinucleotide binding
GO:0071949	0.956	FAD binding
GO:0042393	0.798	histone binding
GO:0140682	0.733	FAD-dependent H3K4me/H3K4me3 demethylase activity
GO:0003676	0.343	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0043170	0.966	macromolecule metabolic process
GO:0016043	0.966	cellular component organization
GO:0019222	0.965	regulation of metabolic process
GO:0044260	0.945	cellular macromolecule metabolic process
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0006807	0.898	nitrogen compound metabolic process
GO:1901564	0.894	organonitrogen compound metabolic process
GO:0080090	0.888	regulation of primary metabolic process
GO:0031323	0.887	regulation of cellular metabolic process
GO:0019219	0.878	regulation of nucleobase-containing compound metabolic process
GO:0006325	0.875	chromatin organization
GO:1901360	0.806	organic cyclic compound metabolic process
GO:0043412	0.806	macromolecule modification
GO:0006725	0.800	cellular aromatic compound metabolic process
GO:0034641	0.798	cellular nitrogen compound metabolic process
GO:0032259	0.747	methylation
GO:0010468	0.677	regulation of gene expression
GO:0046483	0.667	heterocycle metabolic process
GO:0006139	0.656	nucleobase-containing compound metabolic process
GO:0090304	0.586	nucleic acid metabolic process
GO:0019538	0.522	protein metabolic process
GO:0040029	0.508	epigenetic regulation of gene expression
GO:0006304	0.507	DNA modification
GO:0032501	0.458	multicellular organismal process
GO:0016570	0.420	histone modification
GO:0051052	0.389	regulation of DNA metabolic process
GO:0043414	0.382	macromolecule methylation
GO:0044030	0.339	regulation of DNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0032991	0.973	protein-containing complex
GO:0043232	0.514	intracellular non-membrane-bounded organelle
GO:0000786	0.325	nucleosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	0.999	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
RHEA:60244	0.733	2 A + 2 H2O + N(6),N(6)-dimethyl-L-lysyl(4)-[histone H3] = 2 AH2 + 2 formaldehyde + L-lysyl(4)-[histone H3]
EC:1.14.99.66	0.733	[histone-H3]-N(6),N(6)-dimethyl-L-lysine(4) FAD-dependent demethylase.

[back to server]