StarFunc result for job id Q8NBB4

User Input

>input (408 residues)
MLPRPKAPASPRRPQTPTPSEQDADPGPASPRDTEAQRLRFRQFQYHVASGPHLALGQLW
TLCRQWLRPEARSKEQMLELLVLEQFLGALPSKMRTWVQSQGPRSCREAASLVEDLTQMC
QQEVLVSLDSVEPQDWSFGEEEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETT
QLQQSLHTRAEAEAPRAPGLLGSRARLPLKPSIWDEPEDLLAGPSSDLRAEGTVISSPKG
PSAQRISPRRRNRNTDQSGRHQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMV
FTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRES
VPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHGHM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NBB4	1.000	1.000	7.755E-67	408	1.000	1.000	Q8NBB4.pdb.gz	ZSCA1_HUMAN Zinc finger and SCAN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZSCAN1 PE=1 SV=2
2	AFDB:P10073	0.229	0.193	4.568E-19	491	0.319	0.265	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
3	AFDB:Q9EQB9	0.227	0.125	1.473E-18	759	0.301	0.162	Q9EQB9.pdb.gz	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
4	AFDB:Q86W11	0.227	0.189	3.713E-18	494	0.252	0.209	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
5	AFDB:O43309	0.222	0.154	1.354E-17	604	0.275	0.185	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
6	AFDB:P17029	0.226	0.171	1.532E-17	563	0.277	0.201	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
7	AFDB:O14978	0.223	0.141	2.168E-16	683	0.309	0.184	O14978.pdb.gz	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
8	AFDB:Q9Y2L8	0.235	0.117	2.950E-16	839	0.275	0.133	Q9Y2L8.pdb.gz	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
9	AFDB:Q96IT1	0.223	0.161	3.337E-16	587	0.306	0.213	Q96IT1.pdb.gz	ZN496_HUMAN Zinc finger protein 496 OS=Homo sapiens OX=9606 GN=ZNF496 PE=1 SV=1
10	AFDB:Q8CF60	0.249	0.160	4.269E-16	680	0.309	0.185	Q8CF60.pdb.gz	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
11	PDB:3w5kB	0.083	0.236	7.049E-2	110	0.066	0.245	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7v2wJ	0.086	0.142	9.379E-1	236	0.074	0.127	7v2wJ.pdb.gz
13	PDB:6sgaF7	0.089	0.063	1.536	662	0.069	0.042	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
14	PDB:5z56L	0.072	0.081	1.847	342	0.078	0.094	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:5n9jG	0.088	0.190	2.090	163	0.061	0.153	5n9jG.pdb.gz
16	PDB:3gn5A	0.056	0.131	3.638	132	0.027	0.083	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
17	PDB:6swy8	0.083	0.098	3.870	325	0.074	0.092	6swy8.pdb.gz
18	PDB:7dcoL	0.077	0.074	4.116	435	0.074	0.069	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:6id0L	0.087	0.077	4.377	475	0.093	0.080	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:6vvoB	0.068	0.083	4.377	316	0.029	0.038	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NBB4	0.0	824	408	1.000	1.000	ZSCA1_HUMAN Zinc finger and SCAN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZSCAN1 PE=1 SV=2
2	P10073	1.52e-50	179	491	0.360	0.299	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
3	Q3ZBY5	7.48e-40	150	466	0.319	0.279	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
4	A0A0S2Z658	7.59e-40	151	545	0.319	0.239	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
5	Q969J2	7.59e-40	151	545	0.319	0.239	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
6	Q07231	1.38e-39	150	555	0.316	0.232	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
7	I3L4J6	6.64e-39	146	435	0.275	0.257	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
8	Q9H4T2	2.95e-38	143	348	0.292	0.342	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
9	O43309	4.71e-38	147	611	0.319	0.213	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
10	Q9UNY5	5.12e-38	144	417	0.265	0.259	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
11	Q3MJ62	5.30e-38	143	389	0.270	0.283	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
12	Q9Y2L8	1.51e-37	147	839	0.321	0.156	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
13	Q15776	4.32e-37	144	578	0.311	0.220	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
14	P17028	1.30e-36	139	368	0.265	0.293	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
15	Q8NF99	1.35e-36	142	534	0.292	0.223	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
16	Q91VN1	1.57e-36	139	368	0.262	0.291	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
17	Q96LW9	8.20e-36	137	406	0.279	0.281	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
18	Q15697	6.27e-34	132	407	0.306	0.307	ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens OX=9606 GN=ZNF174 PE=1 SV=1
19	Q86W11	2.01e-33	132	494	0.299	0.247	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
20	Q9Y5A6	2.21e-33	132	473	0.282	0.243	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10083 DUF2321	28	15.8	Uncharacterized protein conserved in bacteria (DUF2321)
2	PF07754 HVO_2753_ZBP	61	14.8	Small zinc finger protein HVO_2753-like, Zn-binding pocket
3	PF02023 SCAN	4.2e-33	124.4	SCAN domain
4	PF01428 zf-AN1	1.6e+02	13.8	AN1-like Zinc finger
5	PF00096 zf-C2H2	5.4e-06	37.7	Zinc finger, C2H2 type
6	PF13878 zf-C2H2_3	4.5e+02	12.1	zinc-finger of acetyl-transferase ESCO
7	PF13894 zf-C2H2_4	2	20.5	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	5	18.5	C2H2-type zinc finger
9	PF16278 zf-C2HE	2.9e+02	13.3	C2HE / C2H2 / C2HC zinc-binding finger
10	PF13465 zf-H2C2_2	0.00043	31.8	Zinc-finger double domain
11	PF18439 zf_UBZ	14	16.7	Ubiquitin-Binding Zinc Finger
12	PF09723 Zn-ribbon_8	1.5	20.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252590	0.720	Plasmalemma vesicle-associated protein
2	9606.ENSP00000470123	0.705	Zinc finger and SCAN domain-containing protein 18
3	9606.ENSP00000259883	0.700	PiggyBac transposable element-derived protein 1
4	9606.ENSP00000268655	0.696	Zinc finger protein 174
5	9606.ENSP00000380087	0.639	Zinc finger protein 213
6	9606.ENSP00000260118	0.630	Gamma-glutamyl hydrolase
7	9606.ENSP00000359557	0.590	Protein LDOC1
8	9606.ENSP00000215057	0.547	Myeloid zinc finger 1
9	9606.ENSP00000365858	0.537	Erythroid transcription factor
10	9606.ENSP00000219782	0.535	Myc-associated zinc finger protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.834	transcription regulator activity
GO:0000976	0.820	transcription cis-regulatory region binding
GO:0003700	0.819	DNA-binding transcription factor activity
GO:0000981	0.693	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.609	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.468	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0048518	0.991	positive regulation of biological process
GO:0010604	0.983	positive regulation of macromolecule metabolic process
GO:0048522	0.979	positive regulation of cellular process
GO:0045935	0.916	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.855	positive regulation of RNA metabolic process
GO:0048519	0.829	negative regulation of biological process
GO:0009987	0.812	cellular process
GO:0009892	0.751	negative regulation of metabolic process
GO:0048523	0.742	negative regulation of cellular process
GO:0031328	0.740	positive regulation of cellular biosynthetic process
GO:0010557	0.710	positive regulation of macromolecule biosynthetic process
GO:0045893	0.697	positive regulation of DNA-templated transcription
GO:0031324	0.683	negative regulation of cellular metabolic process
GO:0010605	0.680	negative regulation of macromolecule metabolic process
GO:0051172	0.629	negative regulation of nitrogen compound metabolic process
GO:0045934	0.621	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.618	negative regulation of cellular biosynthetic process
GO:0010558	0.606	negative regulation of macromolecule biosynthetic process
GO:1902679	0.595	negative regulation of RNA biosynthetic process
GO:0045892	0.580	negative regulation of DNA-templated transcription
GO:0006357	0.577	regulation of transcription by RNA polymerase II
GO:0045944	0.343	positive regulation of transcription by RNA polymerase II
GO:0000122	0.322	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005576	0.335	extracellular region
GO:0005615	0.334	extracellular space
GO:0005737	0.326	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]