StarFunc result for job id Q8NBI3

User Input

>input (349 residues)
MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRR
GPGKKEWGPGLPSQAQDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYP
EKENRPPGWERTRKRSREHKRRRDRLRLHQGRALVRGPSSLMKKAELSEAQVLDAAMEES
STSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYED
LKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGL
NNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NBI3	0.999	0.999	7.380E-58	349	1.000	1.000	Q8NBI3.pdb.gz	DRAXI_HUMAN Draxin OS=Homo sapiens OX=9606 GN=DRAXIN PE=1 SV=2
2	AFDB:B6ZI38	0.266	0.266	2.998E-31	349	0.576	0.576	B6ZI38.pdb.gz	DRAXI_CHICK Draxin OS=Gallus gallus OX=9031 GN=DRAXIN PE=1 SV=1
3	AFDB:A0A0B5JFG2	0.180	0.180	2.708E-17	351	0.347	0.345	A0A0B5JFG2.pdb.gz
4	AFDB:Q00IB7	0.102	0.033	8.083E-1	1433	0.140	0.034	Q00IB7.pdb.gz	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
5	PDB:7wrqB	0.086	0.168	1.140	167	0.032	0.066	7wrqB.pdb.gz
6	PDB:2n6oA	0.062	0.562	1.392	35	0.014	0.143	2n6oA.pdb.gz
7	AFDB:A0A2R8RYE8	0.092	0.060	1.574	590	0.140	0.083	A0A2R8RYE8.pdb.gz
8	PDB:6yxxBQ	0.065	0.094	1.701	218	0.032	0.050	6yxxBQ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
9	AFDB:O88689	0.091	0.039	1.799	947	0.126	0.046	O88689.pdb.gz	PCDA4_MOUSE Protocadherin alpha-4 OS=Mus musculus OX=10090 GN=Pcdha4 PE=1 SV=1
10	AFDB:Q91Y20	0.088	0.039	1.923	946	0.132	0.049	Q91Y20.pdb.gz	PCDAA_MOUSE Protocadherin alpha-10 OS=Mus musculus OX=10090 GN=Pcdha10 PE=2 SV=1
11	AFDB:Q9NRI5	0.087	0.043	2.197	854	0.149	0.061	Q9NRI5.pdb.gz	DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=3
12	AFDB:Q91Y11	0.063	0.032	2.511	979	0.149	0.053	Q91Y11.pdb.gz	PCDA9_MOUSE Protocadherin alpha-9 OS=Mus musculus OX=10090 GN=Pcdha9 PE=2 SV=1
13	AFDB:Q9UN73	0.076	0.032	2.511	950	0.135	0.049	Q9UN73.pdb.gz	PCDA6_HUMAN Protocadherin alpha-6 OS=Homo sapiens OX=9606 GN=PCDHA6 PE=2 SV=1
14	PDB:7wffj	0.082	0.132	3.785	173	0.029	0.058	7wffj.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
15	PDB:6v6tA	0.062	0.552	4.046	35	0.014	0.143	6v6tA.pdb.gz
16	PDB:1la4A	0.065	0.618	4.623	34	0.014	0.147	1la4A.pdb.gz
17	PDB:2qskA	0.065	0.224	5.282	95	0.014	0.053	2qskA.pdb.gz
18	PDB:2mc9A	0.072	0.122	6.036	178	0.026	0.051	2mc9A.pdb.gz
19	PDB:2mv2A	0.045	0.091	6.036	148	0.014	0.034	2mv2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PAL1	0.0	508	343	0.768	0.781	DRAXI_MOUSE Draxin OS=Mus musculus OX=10090 GN=Draxin PE=1 SV=2
2	Q8NBI3	0.0	713	349	1.000	1.000	DRAXI_HUMAN Draxin OS=Homo sapiens OX=9606 GN=DRAXIN PE=1 SV=2
3	B6ZI38	2.81e-120	352	349	0.573	0.573	DRAXI_CHICK Draxin OS=Gallus gallus OX=9031 GN=DRAXIN PE=1 SV=1
4	Q4V9H3	6.41e-60	198	360	0.312	0.303	DRAXI_DANRE Draxin OS=Danio rerio OX=7955 GN=draxin PE=1 SV=2
5	Q8VEJ3	0.19	35.4	221	0.089	0.140	DKK4_MOUSE Dickkopf-related protein 4 OS=Mus musculus OX=10090 GN=Dkk4 PE=2 SV=1
6	O54908	0.97	33.5	272	0.083	0.107	DKK1_MOUSE Dickkopf-related protein 1 OS=Mus musculus OX=10090 GN=Dkk1 PE=1 SV=2
7	Q2PS19	2.1	32.7	526	0.046	0.030	Q2PS19_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=si:ch211-238c15.1 PE=2 SV=1
8	O94907	2.5	32.0	266	0.074	0.098	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
9	F1LZH3	4.3	32.0	750	0.057	0.027	F1LZH3_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=3
10	A0A8I5ZTR6	4.8	32.0	3109	0.074	0.008	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
11	A0A8I6ADR1	4.8	32.0	2708	0.074	0.010	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
12	A0A8I6AHL9	4.8	32.0	3316	0.074	0.008	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
13	Q3ZCN5	5.0	31.6	2353	0.063	0.009	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
14	A0A8I6A7B9	5.3	31.6	681	0.057	0.029	A0A8I6A7B9_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=1
15	G5EBL3	6.9	31.2	2962	0.049	0.006	SDC2_CAEEL Sex determination and dosage compensation protein sdc-2 OS=Caenorhabditis elegans OX=6239 GN=sdc-2 PE=1 SV=1
16	Q585S4	8.2	30.8	802	0.037	0.016	Q585S4_TRYB2 EGF-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.60 PE=4 SV=1
17	Q6NYT8	8.7	30.8	408	0.043	0.037	Q6NYT8_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=zgc:77447 PE=2 SV=1
18	P12111	8.8	30.8	3177	0.040	0.004	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
19	P70351	9.7	30.8	747	0.054	0.025	EZH1_MOUSE Histone-lysine N-methyltransferase EZH1 OS=Mus musculus OX=10090 GN=Ezh1 PE=1 SV=1
20	E9PMC9	9.8	30.8	1224	0.074	0.021	E9PMC9_HUMAN EMSY transcriptional repressor, BRCA2 interacting OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15550 Draxin	3.5e-133	456.1	Draxin
2	PF05522 Metallothio_6	3.5e+02	13.1	Metallothionein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294485

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.980	Netrin-1
2	9606.ENSP00000341198	0.904	Neogenin
3	9606.ENSP00000389140	0.859	Netrin receptor DCC
4	9606.ENSP00000261349	0.829	Low-density lipoprotein receptor-related protein 6
5	9606.ENSP00000265171	0.625	Pro-epidermal growth factor
6	9606.ENSP00000267406	0.623	Cerebellin-3
7	9606.ENSP00000383303	0.584	Down syndrome cell adhesion molecule
8	9606.ENSP00000265361	0.557	Semaphorin-3C
9	9606.ENSP00000269503	0.524	Cerebellin-2
10	9606.ENSP00000332737	0.507	Netrin receptor UNC5A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007275	0.996	multicellular organism development
GO:0050896	0.995	response to stimulus
GO:0042221	0.990	response to chemical
GO:0040011	0.986	locomotion
GO:0050794	0.986	regulation of cellular process
GO:0048858	0.986	cell projection morphogenesis
GO:0061564	0.986	axon development
GO:0009605	0.984	response to external stimulus
GO:0001558	0.981	regulation of cell growth
GO:0010975	0.977	regulation of neuron projection development
GO:0032535	0.972	regulation of cellular component size
GO:0050767	0.971	regulation of neurogenesis
GO:0050770	0.970	regulation of axonogenesis
GO:0048583	0.967	regulation of response to stimulus
GO:0006935	0.963	chemotaxis
GO:0007409	0.961	axonogenesis
GO:0007417	0.960	central nervous system development
GO:0031345	0.960	negative regulation of cell projection organization
GO:0061387	0.953	regulation of extent of cell growth
GO:0051093	0.951	negative regulation of developmental process
GO:0048638	0.946	regulation of developmental growth
GO:0010977	0.945	negative regulation of neuron projection development
GO:0007411	0.936	axon guidance
GO:0030308	0.932	negative regulation of cell growth
GO:0051241	0.931	negative regulation of multicellular organismal process
GO:0048513	0.926	animal organ development
GO:0007420	0.913	brain development
GO:0021953	0.911	central nervous system neuron differentiation
GO:0050768	0.905	negative regulation of neurogenesis
GO:0030516	0.904	regulation of axon extension
GO:0048640	0.899	negative regulation of developmental growth
GO:0050771	0.882	negative regulation of axonogenesis
GO:0021515	0.864	cell differentiation in spinal cord
GO:0010941	0.846	regulation of cell death
GO:0030900	0.812	forebrain development
GO:0030517	0.811	negative regulation of axon extension
GO:0023051	0.729	regulation of signaling
GO:0010646	0.728	regulation of cell communication
GO:0009966	0.720	regulation of signal transduction
GO:0048585	0.492	negative regulation of response to stimulus
GO:1901214	0.476	regulation of neuron death
GO:0051716	0.474	cellular response to stimulus
GO:0023052	0.433	signaling
GO:0007154	0.433	cell communication
GO:0043067	0.375	regulation of programmed cell death
GO:0008219	0.363	cell death
GO:0021954	0.350	central nervous system neuron development
GO:0042981	0.349	regulation of apoptotic process
GO:0060548	0.349	negative regulation of cell death
GO:0043066	0.344	negative regulation of apoptotic process
GO:0009968	0.341	negative regulation of signal transduction
GO:0060828	0.329	regulation of canonical Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005886	0.418	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]