StarFunc result for job id Q8NBJ5

User Input

>input (622 residues)
MAAAPRAGRRRGQPLLALLLLLLAPLPPGAPPGADAYFPEERWSPESPLQAPRVLIALLA
RNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPA
EEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLL
IAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLI
DLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEEYGFLPVPLRAHST
LQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPDKMGFDEVFMINLRRRQDRRERMLR
ALQAQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIW
KEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKA
VPRVRNLVEADYSYWTLAYVISLQGARKLLAAEPLSKMLPVDEFLPVMFDKHPVSEYKAH
FSLRNLHAFSVEPLLIYPTHYTGDDGYVSDTETSVVWNNEHVKTDWDRAKSQKMREQQAL
SREAKNSDVLQSPLDSAARDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYK4	0.910	0.905	0.000	626	0.648	0.644	Q8IYK4.pdb.gz	GT252_HUMAN Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
2	AFDB:Q8NBJ5	1.000	1.000	0.000	622	1.000	1.000	Q8NBJ5.pdb.gz	GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
3	AFDB:Q5T4B2	0.854	0.892	3.885E-90	595	0.531	0.555	Q5T4B2.pdb.gz	GT253_HUMAN Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
4	AFDB:Q9VTH0	0.322	0.279	7.711E-21	721	0.103	0.089	Q9VTH0.pdb.gz	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
5	AFDB:Q5U367	0.323	0.273	2.386E-19	741	0.090	0.076	Q5U367.pdb.gz	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
6	AFDB:A0A2R8QKS4	0.327	0.280	3.036E-19	730	0.105	0.089	A0A2R8QKS4.pdb.gz
7	AFDB:Q63321	0.327	0.281	3.036E-19	728	0.095	0.081	Q63321.pdb.gz	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
8	PDB:6fxrA	0.331	0.295	4.100E-19	700	0.096	0.086	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
9	AFDB:A4U7F8	0.334	0.285	4.102E-19	733	0.084	0.071	A4U7F8.pdb.gz	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
10	AFDB:O00469	0.331	0.281	4.914E-19	737	0.092	0.077	O00469.pdb.gz	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
11	AFDB:A0JMD1	0.328	0.282	1.012E-18	730	0.095	0.081	A0JMD1.pdb.gz
12	PDB:4d0tA	0.269	0.328	4.188E-8	496	0.068	0.085	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
13	PDB:2d7iA	0.265	0.302	8.626E-8	536	0.080	0.093	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
14	PDB:4d11C	0.272	0.374	5.924E-7	436	0.071	0.101	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
15	PDB:6r8uA	0.275	0.374	9.590E-7	425	0.068	0.099	6r8uA.pdb.gz	The allosteric control mechanism of bacterial glycogen biosynthesis disclosed by cryoEM
16	PDB:5l6vI	0.241	0.345	2.835E-6	400	0.058	0.090	5l6vI.pdb.gz	Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
17	PDB:5mlzA	0.220	0.355	3.396E-6	355	0.068	0.118	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
18	PDB:4hg6A	0.229	0.196	4.068E-6	747	0.063	0.052	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
19	PDB:3d8vA	0.271	0.336	4.874E-6	478	0.076	0.098	3d8vA.pdb.gz	Structure and function of GlmU from Mycobacterium tuberculosis.
20	PDB:4fixA	0.266	0.264	5.176E-6	629	0.068	0.067	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T4B2	0.0	665	595	0.529	0.553	GT253_HUMAN Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
2	Q8IYK4	0.0	822	626	0.624	0.620	GT252_HUMAN Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
3	Q8NBJ5	0.0	1286	622	1.000	1.000	GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
4	A3KNH4	1.59e-16	85.9	730	0.079	0.067	A3KNH4_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=cb479 PE=1 SV=1
5	Q9VTH0	7.39e-16	83.6	721	0.121	0.104	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
6	Q9R0E2	8.40e-15	80.1	728	0.077	0.066	PLOD1_MOUSE Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Mus musculus OX=10090 GN=Plod1 PE=1 SV=1
7	Q63321	9.28e-14	77.0	728	0.100	0.085	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
8	Q02809	5.81e-13	74.3	727	0.101	0.087	PLOD1_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2
9	Q9R0E1	9.56e-13	73.6	741	0.106	0.089	PLOD3_MOUSE Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Mus musculus OX=10090 GN=Plod3 PE=1 SV=1
10	Q811A3	1.11e-12	73.6	737	0.076	0.064	PLOD2_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Rattus norvegicus OX=10116 GN=Plod2 PE=2 SV=1
11	Q5U367	1.40e-12	73.2	741	0.105	0.088	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
12	Q386C4	1.46e-12	71.6	357	0.076	0.132	Q386C4_TRYB2 Glycosyltransferase family-like protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1400 PE=4 SV=1
13	O00469	2.07e-12	72.8	737	0.069	0.058	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
14	A8WIN7	5.38e-12	71.2	730	0.068	0.058	A8WIN7_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=fc95g08 PE=1 SV=1
15	O60568	3.30e-11	68.9	738	0.105	0.088	PLOD3_HUMAN Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1
16	A4U7F8	3.67e-11	68.6	733	0.068	0.057	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
17	A4U7F9	5.41e-11	68.2	754	0.051	0.042	A4U7F9_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
18	Q383T0	8.04e-10	62.8	307	0.109	0.221	Q383T0_TRYB2 Glycosyl transferase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1750 PE=4 SV=1
19	Q20679	2.00e-08	59.7	730	0.066	0.056	PLOD_CAEEL Multifunctional procollagen lysine hydroxylase and glycosyltransferase OS=Caenorhabditis elegans OX=6239 GN=let-268 PE=1 SV=1
20	B0EWZ9	3.04e-08	57.4	254	0.111	0.272	B0EWZ9_MORCA Beta(1-4) galactosyltransferase OS=Moraxella catarrhalis OX=480 GN=Lgt2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03452 Anp1	7.1	17.6	Anp1
2	PF13704 Glyco_tranf_2_4	1.5e-15	68.9	Glycosyl transferase family 2
3	PF01755 Glyco_transf_25	6.3e-31	119.3	Glycosyltransferase family 25 (LPS biosynthesis protein)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223127	0.953	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
2	9606.ENSP00000196061	0.950	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
3	9606.ENSP00000282903	0.945	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
4	9606.ENSP00000354960	0.911	Procollagen galactosyltransferase 2
5	9606.ENSP00000394085	0.900	Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
6	9606.ENSP00000353654	0.714	Collagen alpha-2(IV) chain
7	9606.ENSP00000340937	0.707	Collagen alpha-1(XVII) chain
8	9606.ENSP00000331902	0.704	Collagen alpha-5(IV) chain
9	9606.ENSP00000355180	0.704	Collagen alpha-1(VI) chain
10	9606.ENSP00000364979	0.702	Collagen alpha-1(IV) chain
11	9606.ENSP00000304408	0.672	Collagen alpha-1(III) chain
12	9606.ENSP00000325146	0.668	Collagen alpha-1(XII) chain
13	9606.ENSP00000264828	0.655	Collagen alpha-3(V) chain
14	9606.ENSP00000351767	0.653	Collagen alpha-1(XX) chain
15	9606.ENSP00000341640	0.651	Collagen alpha-3(IX) chain
16	9606.ENSP00000297268	0.649	Collagen alpha-2(I) chain
17	9606.ENSP00000362776	0.649	Collagen alpha-1(XVI) chain
18	9606.ENSP00000225964	0.646	Collagen alpha-1(I) chain
19	9606.ENSP00000300527	0.642	Collagen alpha-2(VI) chain
20	9606.ENSP00000318234	0.642	Collagen type XXVI alpha 1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	1.000	catalytic activity, acting on a protein
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0005515	0.996	protein binding
GO:0050211	0.983	procollagen galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071840	0.927	cellular component organization or biogenesis
GO:0016043	0.915	cellular component organization
GO:0030198	0.768	extracellular matrix organization
GO:0065007	0.684	biological regulation
GO:0050789	0.660	regulation of biological process
GO:0050794	0.653	regulation of cellular process
GO:0030199	0.606	collagen fibril organization
GO:0048518	0.307	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005788	0.999	endoplasmic reticulum lumen
GO:0016020	0.996	membrane
GO:0005576	0.766	extracellular region
GO:0071944	0.481	cell periphery
GO:0031981	0.324	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:12637	0.983	(5R)-5-hydroxy-L-lysyl-[collagen] + UDP-alpha-D-galactose = (5R)-5-O-(beta-D-galactosyl)-5-hydroxy-L-lysyl-[collagen] + H(+) + UDP
EC:2.4.1.50	0.983	procollagen galactosyltransferase.

[back to server]