StarFunc result for job id Q8NBJ9

User Input

>input (832 residues)
MFALGLPFLVLLVASVESHLGVLGPKNVSQKDAEFERTYVDEVNSELVNIYTFNHTVTRN
RTEGVRVSVNVLNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPP
TKNESEIQFFYVDVSTLSPVNTTYQLRVSRMDDFVLRTGEQFSFNTTAAQPQYFKYEFPE
GVDSVIVKVTSNKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDFPS
NSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHRQKTLSVLVSQAVTSEAYVSGMLFC
LGIFLSFYLLTVLLACWENWRQKKKTLLVAIDRACPESGHPRVLADSFPGSSPYEGYNYG
SFENVSGSTDGLVDSAGTGDLSYGYQGRSFEPVGTRPRVDSMSSVEEDDYDTLTDIDSDK
NVIRTKQYLYVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGN
QDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLCALE
CGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHP
DINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKL
DSGIFRRILHVLYTDCIRQCSGPLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLA
IGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAES
REHNRDCILLDFFDDHDIWHFLSSIAMFGSFLVLLTLDDDLDTVQRDKIYVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CIF6	0.945	0.945	0.000	832	0.954	0.954	Q8CIF6.pdb.gz	SIDT2_MOUSE SID1 transmembrane family member 2 OS=Mus musculus OX=10090 GN=Sidt2 PE=1 SV=1
2	AFDB:Q6AXF6	0.871	0.876	2.411E-97	827	0.579	0.583	Q6AXF6.pdb.gz	SIDT1_MOUSE SID1 transmembrane family member 1 OS=Mus musculus OX=10090 GN=Sidt1 PE=1 SV=1
3	AFDB:Q9GYF0	0.794	0.872	1.560E-60	756	0.305	0.336	Q9GYF0.pdb.gz	CHUP1_CAEEL Cholesterol uptake protein 1 OS=Caenorhabditis elegans OX=6239 GN=chup-1 PE=1 SV=1
4	AFDB:Q9GZC8	0.605	0.645	1.101E-36	776	0.181	0.195	Q9GZC8.pdb.gz	SID1_CAEEL Systemic RNA interference defective protein 1 OS=Caenorhabditis elegans OX=6239 GN=sid-1 PE=1 SV=2
5	AFDB:A0A024R906	0.090	0.088	5.699E-5	855	0.054	0.053	A0A024R906.pdb.gz
6	AFDB:Q9VYC7	0.098	0.116	1.497E-4	677	0.071	0.087	Q9VYC7.pdb.gz	Q9VYC7_DROME GH11189p OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=2
7	AFDB:Q54XS3	0.071	0.039	2.313E-4	1661	0.061	0.031	Q54XS3.pdb.gz	GDT1_DICDI Probable inactive serine/threonine-protein kinase gdt1 OS=Dictyostelium discoideum OX=44689 GN=gdt1 PE=1 SV=1
8	AFDB:Q582C4	0.086	0.058	6.692E-4	1339	0.053	0.033	Q582C4.pdb.gz	Q582C4_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.520 PE=3 SV=1
9	AFDB:Q8VXV4	0.108	0.194	8.520E-4	436	0.036	0.069	Q8VXV4.pdb.gz	DNJ16_ARATH Chaperone protein dnaJ 16 OS=Arabidopsis thaliana OX=3702 GN=ATJ16 PE=2 SV=1
10	AFDB:P43146	0.063	0.040	2.238E-3	1447	0.077	0.044	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
11	PDB:3lxuX	0.110	0.084	1.051E-2	1217	0.049	0.034	3lxuX.pdb.gz
12	PDB:7b01A	0.110	0.147	2.390E-2	588	0.024	0.034	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
13	PDB:1uijC	0.067	0.138	3.042E-2	346	0.031	0.075	1uijC.pdb.gz
14	PDB:5eiyB	0.123	0.147	3.193E-2	658	0.031	0.040	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
15	PDB:6g7oA	0.154	0.340	3.351E-2	350	0.046	0.109	6g7oA.pdb.gz	Structure of a human intramembrane ceramidase explains enzymatic dysfunction found in leukodystrophy.
16	PDB:5iz5A	0.061	0.065	4.699E-2	757	0.030	0.033	5iz5A.pdb.gz
17	PDB:4dxzA	0.094	0.515	4.931E-2	111	0.022	0.162	4dxzA.pdb.gz
18	PDB:5wq7A	0.050	0.075	4.931E-2	472	0.047	0.083	5wq7A.pdb.gz
19	PDB:6behB	0.069	0.093	6.915E-2	544	0.025	0.039	6behB.pdb.gz	Structural basis for the inhibition of poxvirus assembly by the antibiotic rifampicin.
20	PDB:5iz5B	0.060	0.066	8.804E-2	746	0.029	0.032	5iz5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DZN7	0.0	1480	733	0.856	0.971	B4DZN7_HUMAN cDNA FLJ61501, highly similar to SID1 transmembrane family member 2 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q6AXF6	0.0	912	827	0.553	0.556	SIDT1_MOUSE SID1 transmembrane family member 1 OS=Mus musculus OX=10090 GN=Sidt1 PE=1 SV=1
3	Q8CIF6	0.0	1585	832	0.954	0.954	SIDT2_MOUSE SID1 transmembrane family member 2 OS=Mus musculus OX=10090 GN=Sidt2 PE=1 SV=1
4	Q8NBJ9	0.0	1722	832	1.000	1.000	SIDT2_HUMAN SID1 transmembrane family member 2 OS=Homo sapiens OX=9606 GN=SIDT2 PE=1 SV=2
5	Q9NXL6	0.0	934	827	0.550	0.554	SIDT1_HUMAN SID1 transmembrane family member 1 OS=Homo sapiens OX=9606 GN=SIDT1 PE=2 SV=2
6	Q9GYF0	4.82e-87	294	756	0.194	0.213	CHUP1_CAEEL Cholesterol uptake protein 1 OS=Caenorhabditis elegans OX=6239 GN=chup-1 PE=1 SV=1
7	Q9GZC8	8.07e-37	150	776	0.123	0.131	SID1_CAEEL Systemic RNA interference defective protein 1 OS=Caenorhabditis elegans OX=6239 GN=sid-1 PE=1 SV=2
8	Q8R2H3	0.38	36.2	308	0.029	0.078	BSND_RAT Barttin OS=Rattus norvegicus OX=10116 GN=Bsnd PE=1 SV=1
9	Q8WZ55	1.1	34.7	320	0.028	0.072	BSND_HUMAN Barttin OS=Homo sapiens OX=9606 GN=BSND PE=1 SV=1
10	Q8VIM4	2.0	33.9	307	0.026	0.072	BSND_MOUSE Barttin OS=Mus musculus OX=10090 GN=Bsnd PE=1 SV=3
11	Q9JMD3	3.1	33.5	291	0.044	0.127	STA10_MOUSE START domain-containing protein 10 OS=Mus musculus OX=10090 GN=Stard10 PE=1 SV=1
12	Q6J4K2	4.6	33.1	584	0.026	0.038	NCLX_HUMAN Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2
13	P15639	9.1	32.3	529	0.025	0.040	PUR9_ECOLI Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12) OX=83333 GN=purH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13965 SID-1_RNA_chan	7.9e-287	964.3	dsRNA-gated channel SID-1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314023

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326227	0.723	Neutral alpha-glucosidase C
2	9606.ENSP00000264079	0.664	Mucolipin-1
3	9606.ENSP00000342609	0.539	Alkaline ceramidase 2
4	9606.ENSP00000370376	0.512	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
5	9606.ENSP00000244137	0.506	Xaa-Pro dipeptidase
6	9606.ENSP00000413150	0.502	Uncharacterized protein C1orf226

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003725	1.000	double-stranded RNA binding
GO:0005515	0.999	protein binding
GO:0022884	0.985	macromolecule transmembrane transporter activity
GO:0015932	0.961	nucleobase-containing compound transmembrane transporter activity
GO:0044877	0.872	protein-containing complex binding
GO:0051032	0.793	nucleic acid transmembrane transporter activity
GO:0035650	0.623	AP-1 adaptor complex binding
GO:0035612	0.622	AP-2 adaptor complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050658	0.960	RNA transport
GO:0009987	0.863	cellular process
GO:0008152	0.759	metabolic process
GO:0071704	0.559	organic substance metabolic process
GO:0044238	0.521	primary metabolic process
GO:0044237	0.512	cellular metabolic process
GO:0006807	0.400	nitrogen compound metabolic process
GO:0065007	0.308	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005765	1.000	lysosomal membrane
GO:0005886	0.998	plasma membrane
GO:0012505	0.789	endomembrane system
GO:0005634	0.469	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]