StarFunc result for job id Q8NBK3

User Input

>input (374 residues)
MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGA
HGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT
IDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWW
LPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLH
NRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWE
WTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASN
LGFRCAADRLPTMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NBK3	1.000	1.000	4.197E-80	374	1.000	1.000	Q8NBK3.pdb.gz	SUMF1_HUMAN Formylglycine-generating enzyme OS=Homo sapiens OX=9606 GN=SUMF1 PE=1 SV=3
2	AFDB:Q8R0F3	0.791	0.795	1.186E-70	372	0.861	0.866	Q8R0F3.pdb.gz	SUMF1_MOUSE Formylglycine-generating enzyme OS=Mus musculus OX=10090 GN=Sumf1 PE=1 SV=2
3	AFDB:D1A7C3	0.724	0.891	3.605E-47	303	0.439	0.541	D1A7C3.pdb.gz	FGE_THECD Formylglycine-generating enzyme OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) OX=471852 GN=Tcur_4811 PE=1 SV=1
4	PDB:6s07A	0.731	0.899	7.210E-46	303	0.444	0.548	6s07A.pdb.gz	Structure of formylglycine-generating enzyme in complex with copper and a substrate reveals an acidic pocket for binding and activation of molecular oxygen.
5	AFDB:Q9F3C7	0.736	0.873	3.758E-44	314	0.409	0.487	Q9F3C7.pdb.gz	FGE_STRCO Formylglycine-generating enzyme OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO7548 PE=1 SV=1
6	PDB:6mujB	0.723	0.916	1.364E-43	294	0.404	0.514	6mujB.pdb.gz	Formylglycine-generating enzyme binds substrate directly at a mononuclear Cu(I) center to initiate O2activation.
7	AFDB:Q8BPG6	0.669	0.809	7.269E-36	308	0.358	0.435	Q8BPG6.pdb.gz	SUMF2_MOUSE Inactive C-alpha-formylglycine-generating enzyme 2 OS=Mus musculus OX=10090 GN=Sumf2 PE=1 SV=2
8	AFDB:Q8NBJ7	0.674	0.831	1.706E-35	301	0.356	0.442	Q8NBJ7.pdb.gz	SUMF2_HUMAN Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2
9	PDB:1y4jB	0.659	0.910	3.413E-34	268	0.353	0.493	1y4jB.pdb.gz	Crystal Structure of Human pFGE, the Paralog of the C{alpha}-formylglycine-generating Enzyme
10	AFDB:I6Y8I5	0.646	0.803	8.560E-33	299	0.326	0.408	I6Y8I5.pdb.gz	FGE_MYCTU Formylglycine-generating enzyme OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0712 PE=1 SV=1
11	AFDB:A5FIS8	0.567	0.461	1.096E-23	464	0.243	0.196	A5FIS8.pdb.gz	A5FIS8_FLAJ1 GldK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=gldK PE=4 SV=1
12	PDB:5hhaB	0.538	0.727	2.079E-17	272	0.198	0.272	5hhaB.pdb.gz	Crystal structure of Chromophore maturation protein from Pseudomonas aeruginosa
13	PDB:1yu2A	0.305	0.303	5.684E-6	377	0.110	0.109	1yu2A.pdb.gz
14	PDB:7wz8A	0.151	0.286	4.774E-1	180	0.056	0.117	7wz8A.pdb.gz
15	AFDB:Q5U651	0.050	0.024	1.334	963	0.080	0.031	Q5U651.pdb.gz	RAIN_HUMAN Ras-interacting protein 1 OS=Homo sapiens OX=9606 GN=RASIP1 PE=1 SV=1
16	AFDB:Q3LRZ3	0.055	0.052	2.173	400	0.061	0.058	Q3LRZ3.pdb.gz	AXLP1_CAEEL Axin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=axl-1 PE=1 SV=1
17	PDB:1qzeA	0.058	0.087	2.631	214	0.029	0.051	1qzeA.pdb.gz
18	PDB:4im0A	0.061	0.044	3.358	619	0.053	0.032	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
19	PDB:6oidA	0.049	0.061	3.569	289	0.024	0.031	6oidA.pdb.gz	A redox-active switch in fructosamine-3-kinases expands the regulatory repertoire of the protein kinase superfamily.
20	PDB:4yknA	0.061	0.025	3.793	1205	0.011	0.003	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NBK3	0.0	778	374	1.000	1.000	SUMF1_HUMAN Formylglycine-generating enzyme OS=Homo sapiens OX=9606 GN=SUMF1 PE=1 SV=3
2	Q8R0F3	0.0	645	372	0.861	0.866	SUMF1_MOUSE Formylglycine-generating enzyme OS=Mus musculus OX=10090 GN=Sumf1 PE=1 SV=2
3	D1A7C3	7.19e-118	345	303	0.441	0.545	FGE_THECD Formylglycine-generating enzyme OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) OX=471852 GN=Tcur_4811 PE=1 SV=1
4	Q9F3C7	2.65e-101	304	314	0.396	0.471	FGE_STRCO Formylglycine-generating enzyme OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO7548 PE=1 SV=1
5	Q8NBJ7	2.90e-86	265	301	0.356	0.442	SUMF2_HUMAN Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2
6	Q8BPG6	1.27e-83	258	308	0.366	0.445	SUMF2_MOUSE Inactive C-alpha-formylglycine-generating enzyme 2 OS=Mus musculus OX=10090 GN=Sumf2 PE=1 SV=2
7	I6Y8I5	1.93e-67	216	299	0.324	0.405	FGE_MYCTU Formylglycine-generating enzyme OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0712 PE=1 SV=1
8	P95060	1.93e-67	216	299	0.324	0.405	P95060_MYCTO Sulfatase-modifying factor enzyme domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0739 PE=4 SV=2
9	Q9I185	6.51e-19	87.8	284	0.201	0.264	Q9I185_PSEAE PvdO OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdO PE=1 SV=1
10	A5FIS8	5.63e-18	87.4	464	0.168	0.136	A5FIS8_FLAJ1 GldK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=gldK PE=4 SV=1
11	A0R5N0	1.26e-11	67.8	428	0.246	0.215	EGTB_MYCS2 Hercynine oxygenase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=egtB PE=1 SV=1
12	V9TSX0	3.38e-06	50.4	280	0.160	0.214	LPPX_PAEBA Chaperone protein LppX OS=Paenibacillus barcinonensis OX=198119 GN=lppX PE=3 SV=1
13	A5FJM9	0.011	40.0	561	0.080	0.053	A5FJM9_FLAJ1 GldJ OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=gldJ PE=4 SV=2
14	Q582P2	0.021	39.3	749	0.134	0.067	Q582P2_TRYB2 Generic methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.700 PE=4 SV=1
15	Q9P1Z9	0.87	34.3	1701	0.053	0.012	CC180_HUMAN Coiled-coil domain-containing protein 180 OS=Homo sapiens OX=9606 GN=CCDC180 PE=2 SV=3
16	Q9P260	3.0	32.7	1216	0.112	0.035	RELCH_HUMAN RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03781 FGE-sulfatase	2.7e-85	297.7	Sulfatase-modifying factor enzyme 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272902

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216124	0.985	Arylsulfatase A
2	9606.ENSP00000264914	0.983	Arylsulfatase B
3	9606.ENSP00000370522	0.979	Arylsulfatase family member H
4	9606.ENSP00000333395	0.974	Arylsulfatase I
5	9606.ENSP00000407193	0.971	Arylsulfatase G
6	9606.ENSP00000217961	0.969	Steryl-sulfatase
7	9606.ENSP00000320219	0.967	Arylsulfatase family member J
8	9606.ENSP00000369346	0.964	Arylsulfatase family member K
9	9606.ENSP00000441417	0.958	Arylsulfatase E
10	9606.ENSP00000370546	0.955	Arylsulfatase D
11	9606.ENSP00000370519	0.954	Arylsulfatase F
12	9606.ENSP00000314606	0.923	N-sulphoglucosamine sulphohydrolase
13	9606.ENSP00000268695	0.917	N-acetylgalactosamine-6-sulfatase
14	9606.ENSP00000339801	0.872	Iduronate 2-sulfatase
15	9606.ENSP00000341938	0.862	Sulfatase-modifying factor 2
16	9606.ENSP00000258145	0.767	N-acetylglucosamine-6-sulfatase
17	9606.ENSP00000247933	0.748	Alpha-L-iduronidase
18	9606.ENSP00000262455	0.735	Endoplasmic reticulum resident protein 44
19	9606.ENSP00000256496	0.732	ADP-ribosylation factor-like protein 8B
20	9606.ENSP00000380602	0.720	Contactin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0016670	0.995	oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor
GO:0043169	0.988	cation binding
GO:0046914	0.981	transition metal ion binding
GO:0005507	0.948	copper ion binding
GO:0120147	0.943	formylglycine-generating oxidase activity
GO:1901681	0.650	sulfur compound binding
GO:1903135	0.460	cupric ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:1901135	0.986	carbohydrate derivative metabolic process
GO:0019538	0.979	protein metabolic process
GO:0006643	0.929	membrane lipid metabolic process
GO:0006664	0.919	glycolipid metabolic process
GO:0006665	0.908	sphingolipid metabolic process
GO:0043687	0.875	post-translational protein modification
GO:0006687	0.725	glycosphingolipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0070013	0.996	intracellular organelle lumen
GO:0005788	0.882	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.3.-	0.995	With oxygen as acceptor.
RHEA:51152	0.943	2 a thiol + L-cysteinyl-[sulfatase] + O2 = 3-oxo-L-alanyl-[sulfatase] + an organic disulfide + H(+) + H2O + hydrogen sulfide
EC:1.8.3.7	0.943	formylglycine-generating enzyme.

[back to server]