StarFunc result for job id Q8NBL3

User Input

>input (297 residues)
MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLM
PLSHLPLRDSPPLGRRLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYF
LGIDRDIDTLILKGIAQRCTAIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGF
LGMAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLP
KLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CZ16	0.945	0.945	1.094E-44	297	0.983	0.983	Q9CZ16.pdb.gz	T178A_MOUSE Transmembrane protein 178A OS=Mus musculus OX=10090 GN=Tmem178a PE=1 SV=3
2	AFDB:Q9D563	0.580	0.762	5.996E-10	222	0.162	0.216	Q9D563.pdb.gz	TM114_MOUSE Transmembrane protein 114 OS=Mus musculus OX=10090 GN=Tmem114 PE=1 SV=1
3	AFDB:B3SHH9	0.566	0.744	1.642E-9	223	0.178	0.238	B3SHH9.pdb.gz	TM114_HUMAN Transmembrane protein 114 OS=Homo sapiens OX=9606 GN=TMEM114 PE=1 SV=2
4	AFDB:Q9VX17	0.613	0.627	4.739E-9	290	0.165	0.169	Q9VX17.pdb.gz	Q9VX17_DROME LD36024p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6398 PE=2 SV=1
5	PDB:7rz4A	0.501	0.164	1.254E-8	993	0.182	0.054	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
6	AFDB:B1AQL3	0.542	0.749	1.443E-8	211	0.172	0.242	B1AQL3.pdb.gz	TM235_MOUSE Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3
7	AFDB:Q8VHW8	0.515	0.553	2.873E-8	275	0.189	0.204	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
8	AFDB:Q9CQX5	0.538	0.624	3.195E-8	253	0.189	0.221	Q9CQX5.pdb.gz	CLDN1_MOUSE Claudin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Cldnd1 PE=1 SV=1
9	PDB:7ocaI	0.511	0.796	6.152E-8	185	0.168	0.270	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
10	AFDB:P62955	0.519	0.558	7.075E-8	275	0.178	0.193	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
11	AFDB:Q8WXS5	0.548	0.393	1.937E-7	425	0.185	0.129	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
12	AFDB:Q8VHW9	0.537	0.491	2.525E-7	327	0.178	0.162	Q8VHW9.pdb.gz	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
13	PDB:5weoA	0.518	0.168	1.197E-6	988	0.148	0.045	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
14	PDB:5b2gC	0.441	0.379	1.695E-5	350	0.114	0.097	5b2gC.pdb.gz
15	PDB:6ov2A	0.443	0.697	1.413E-4	182	0.114	0.187	6ov2A.pdb.gz
16	PDB:5kbtA	0.453	0.156	1.842E-4	973	0.141	0.043	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
17	PDB:6jp5E	0.411	0.683	2.669E-4	169	0.138	0.243	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
18	PDB:7rzaA	0.475	0.152	3.299E-4	981	0.114	0.035	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
19	PDB:6c14B	0.321	0.558	4.672E-3	164	0.088	0.159	6c14B.pdb.gz
20	PDB:6wxuB	0.355	0.381	6.090E-3	273	0.101	0.110	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CZ16	0.0	598	297	0.983	0.983	T178A_MOUSE Transmembrane protein 178A OS=Mus musculus OX=10090 GN=Tmem178a PE=1 SV=3
2	P62955	1.59e-04	44.7	275	0.125	0.135	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
3	P62956	1.59e-04	44.7	275	0.125	0.135	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
4	P62957	1.59e-04	44.7	275	0.125	0.135	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
5	Q8VHW8	0.002	41.6	275	0.131	0.142	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
6	Q9UF02	0.002	41.6	275	0.135	0.145	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
7	Q8WXS5	0.048	37.4	425	0.165	0.115	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
8	Q8VHW5	0.14	36.2	421	0.162	0.114	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1
9	Q8VHW2	0.15	35.8	423	0.162	0.113	CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit OS=Mus musculus OX=10090 GN=Cacng8 PE=1 SV=1
10	P9WQH9	0.23	35.4	495	0.098	0.059	ACCD3_MYCTU Probable biotin-dependent acyl-coenzyme A carboxylase beta3 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD3 PE=1 SV=1
11	Q5ZPR3	0.23	35.4	534	0.077	0.043	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
12	Q6PFS3	2.0	32.3	324	0.145	0.133	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
13	D4A4F4	2.4	32.3	461	0.071	0.046	D4A4F4_RAT Ngfi-A binding protein 2 OS=Rattus norvegicus OX=10116 GN=Nab2 PE=1 SV=2
14	O88602	2.6	32.0	323	0.155	0.142	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
15	Q71RJ2	2.6	32.0	323	0.155	0.142	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
16	Q9Y698	2.6	32.0	323	0.155	0.142	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
17	Q61127	2.8	32.0	525	0.071	0.040	NAB2_MOUSE NGFI-A-binding protein 2 OS=Mus musculus OX=10090 GN=Nab2 PE=1 SV=2
18	Q5VUA4	3.1	32.0	2279	0.067	0.009	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
19	Q15742	3.3	32.0	525	0.071	0.040	NAB2_HUMAN NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1
20	Q06432	4.7	30.8	222	0.077	0.104	CCG1_HUMAN Voltage-dependent calcium channel gamma-1 subunit OS=Homo sapiens OX=9606 GN=CACNG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	4.3e-15	67.5	PMP-22/EMP/MP20/Claudin tight junction
2	PF07803 GSG-1	76	14.6	GSG1-like protein
3	PF00822 PMP22_Claudin	0.74	21.2	PMP-22/EMP/MP20/Claudin family
4	PF17555 TssN	4.4e+02	11.7	Type VI secretion system, TssN

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008615

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008505	0.665	DExH-box helicase 57
2	60711.ENSCSAP00000009369	0.637	Small nuclear RNA activating complex, polypeptide 5, 19kDa
3	60711.ENSCSAP00000002881	0.608	Transportin 2
4	60711.ENSCSAP00000002292	0.562	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
5	60711.ENSCSAP00000007180	0.557	Hexosyltransferase
6	60711.ENSCSAP00000005990	0.544	Transmembrane protein 179
7	60711.ENSCSAP00000003023	0.541	Family with sequence similarity 189, member A1
8	60711.ENSCSAP00000017316	0.540	Transmembrane protein 88B
9	60711.ENSCSAP00000007332	0.536	Chromodomain helicase DNA binding protein 3
10	60711.ENSCSAP00000008703	0.536	Family with sequence similarity 171, member B
11	60711.ENSCSAP00000003356	0.532	Kinase D-interacting substrate, 220kDa
12	60711.ENSCSAP00000017792	0.523	APC membrane recruitment protein 3
13	60711.ENSCSAP00000014597	0.521	Transmembrane protein 145

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.993	regulation of biological process
GO:0048878	0.985	chemical homeostasis
GO:0098771	0.984	inorganic ion homeostasis
GO:0055080	0.976	monoatomic cation homeostasis
GO:0060284	0.975	regulation of cell development
GO:0051241	0.972	negative regulation of multicellular organismal process
GO:1903706	0.971	regulation of hemopoiesis
GO:0045596	0.959	negative regulation of cell differentiation
GO:0055074	0.947	calcium ion homeostasis
GO:0030003	0.942	intracellular monoatomic cation homeostasis
GO:0006874	0.932	intracellular calcium ion homeostasis
GO:0045637	0.926	regulation of myeloid cell differentiation
GO:1902105	0.922	regulation of leukocyte differentiation
GO:0045638	0.921	negative regulation of myeloid cell differentiation
GO:1903707	0.921	negative regulation of hemopoiesis
GO:1902106	0.899	negative regulation of leukocyte differentiation
GO:0045670	0.898	regulation of osteoclast differentiation
GO:0051480	0.877	regulation of cytosolic calcium ion concentration
GO:0002762	0.762	negative regulation of myeloid leukocyte differentiation
GO:0009987	0.715	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0031090	0.996	organelle membrane
GO:0005783	0.992	endoplasmic reticulum
GO:0031984	0.991	organelle subcompartment
GO:0042175	0.980	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.980	endoplasmic reticulum subcompartment
GO:0005789	0.966	endoplasmic reticulum membrane
GO:0071944	0.745	cell periphery
GO:0005886	0.705	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]