StarFunc result for job id Q8NBM4

User Input

>input (344 residues)
MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICG
RIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGI
TAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIW
IVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLD
IQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAA
PPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NBM4	1.000	1.000	2.349E-49	344	1.000	1.000	Q8NBM4.pdb.gz	UBAC2_HUMAN Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBAC2 PE=1 SV=1
2	AFDB:Q8R1K1	0.752	0.750	1.162E-41	345	0.892	0.890	Q8R1K1.pdb.gz	UBAC2_MOUSE Ubiquitin-associated domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ubac2 PE=1 SV=1
3	AFDB:Q9LET3	0.581	0.674	1.411E-14	293	0.262	0.307	Q9LET3.pdb.gz	RBL20_ARATH Rhomboid-like protein 20 OS=Arabidopsis thaliana OX=3702 GN=RBL20 PE=2 SV=1
4	AFDB:Q8RXQ2	0.544	0.643	4.850E-14	287	0.265	0.317	Q8RXQ2.pdb.gz	RBL18_ARATH Rhomboid-like protein 18 OS=Arabidopsis thaliana OX=3702 GN=RBL18 PE=2 SV=1
5	AFDB:Q9UTK7	0.508	0.475	2.961E-9	372	0.235	0.218	Q9UTK7.pdb.gz	DSC2_SCHPO DSC E3 ubiquitin ligase complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dsc2 PE=1 SV=1
6	AFDB:Q5ANB9	0.466	0.480	4.992E-9	333	0.157	0.162	Q5ANB9.pdb.gz	Q5ANB9_CANAL Derlin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C305110WA PE=4 SV=1
7	AFDB:Q08232	0.533	0.566	5.367E-8	322	0.192	0.205	Q08232.pdb.gz	DSC2_YEAST DSC E3 ubiquitin ligase complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSC2 PE=1 SV=1
8	AFDB:Q57TV1	0.418	0.390	2.829E-7	371	0.218	0.202	Q57TV1.pdb.gz	Q57TV1_TRYB2 UBA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.440 PE=4 SV=1
9	AFDB:F4J5V3	0.475	0.396	3.189E-6	426	0.209	0.169	F4J5V3.pdb.gz	F4J5V3_ARATH RHOMBOID-like protein 15 OS=Arabidopsis thaliana OX=3702 GN=RBL15 PE=1 SV=1
10	AFDB:Q12893	0.375	0.369	7.514E-4	351	0.140	0.137	Q12893.pdb.gz	TM115_HUMAN Transmembrane protein 115 OS=Homo sapiens OX=9606 GN=TMEM115 PE=1 SV=1
11	PDB:2nr9A	0.353	0.575	3.832E-2	192	0.113	0.203	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
12	PDB:3odjA	0.325	0.645	9.449E-2	157	0.084	0.185	3odjA.pdb.gz
13	PDB:3ihpB	0.119	0.061	4.982E-1	681	0.055	0.028	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
14	PDB:7o3vI	0.105	0.158	8.010E-1	193	0.067	0.119	7o3vI.pdb.gz
15	PDB:5ogeG	0.107	0.114	8.809E-1	306	0.110	0.124	5ogeG.pdb.gz
16	PDB:3e46A	0.115	0.194	9.686E-1	202	0.038	0.064	3e46A.pdb.gz
17	PDB:4ybqB	0.123	0.103	1.228	462	0.081	0.061	4ybqB.pdb.gz
18	PDB:4httA	0.175	0.236	1.485	225	0.096	0.147	4httA.pdb.gz
19	PDB:6vk0C	0.307	0.507	1.485	180	0.084	0.161	6vk0C.pdb.gz
20	PDB:6vgcD	0.090	0.160	1.558	155	0.084	0.187	6vgcD.pdb.gz	Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NBM4	0.0	702	344	1.000	1.000	UBAC2_HUMAN Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBAC2 PE=1 SV=1
2	Q8R1K1	0.0	594	345	0.892	0.890	UBAC2_MOUSE Ubiquitin-associated domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ubac2 PE=1 SV=1
3	Q9LET3	1.31e-23	100	293	0.279	0.328	RBL20_ARATH Rhomboid-like protein 20 OS=Arabidopsis thaliana OX=3702 GN=RBL20 PE=2 SV=1
4	Q8RXQ2	7.08e-22	95.9	287	0.265	0.317	RBL18_ARATH Rhomboid-like protein 18 OS=Arabidopsis thaliana OX=3702 GN=RBL18 PE=2 SV=1
5	Q5ANB9	4.09e-05	47.4	333	0.067	0.069	Q5ANB9_CANAL Derlin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C305110WA PE=4 SV=1
6	Q57TV1	2.26e-04	45.1	371	0.201	0.186	Q57TV1_TRYB2 UBA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.440 PE=4 SV=1
7	Q1MT86	6.33e-04	43.9	853	0.067	0.027	Q1MT86_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fa06b05 PE=1 SV=1
8	P45974	0.002	42.7	858	0.067	0.027	UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2
9	P56399	0.002	42.7	858	0.067	0.027	UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus OX=10090 GN=Usp5 PE=1 SV=1
10	Q4V973	0.002	42.7	834	0.064	0.026	Q4V973_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fc21h02 PE=1 SV=1
11	Q9UTK7	0.016	39.3	372	0.238	0.220	DSC2_SCHPO DSC E3 ubiquitin ligase complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dsc2 PE=1 SV=1
12	Q92995	0.021	39.3	863	0.052	0.021	UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13 PE=1 SV=2
13	A0A1D8PF53	0.045	38.1	1296	0.058	0.015	A0A1D8PF53_CANAL Cta3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTA3 PE=4 SV=1
14	F4J5V3	0.053	37.7	426	0.049	0.040	F4J5V3_ARATH RHOMBOID-like protein 15 OS=Arabidopsis thaliana OX=3702 GN=RBL15 PE=1 SV=1
15	O94685	0.077	37.4	829	0.061	0.025	UCP8_SCHPO UBA domain-containing protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp8 PE=1 SV=2
16	Q10256	0.12	36.6	332	0.055	0.057	MUD1_SCHPO UBA domain-containing protein Mud1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mud1 PE=1 SV=1
17	F4KCN6	0.14	35.4	171	0.052	0.105	F4KCN6_ARATH Ubiquitin receptor RAD23 OS=Arabidopsis thaliana OX=3702 GN=At5g16090 PE=3 SV=1
18	Q11119	0.38	35.0	775	0.049	0.022	UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp14 PE=1 SV=2
19	A0A140VK64	0.41	35.0	405	0.047	0.040	A0A140VK64_HUMAN Ubiquitin-associated domain-containing protein 1 OS=Homo sapiens OX=9606 PE=2 SV=1
20	Q9BSL1	0.41	35.0	405	0.047	0.040	UBAC1_HUMAN Ubiquitin-associated domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBAC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01694 Rhomboid	23	16.4	Rhomboid family
2	PF15841 TMEM239	1.8e+02	13.4	Transmembrane protein 239 family
3	PF00627 UBA	1.4e-08	45.8	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383911

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261942	0.999	FAS-associated factor 2
2	9606.ENSP00000290649	0.953	E3 ubiquitin-protein ligase AMFR
3	9606.ENSP00000479216	0.925	UBX domain-containing protein 8
4	9606.ENSP00000351777	0.868	Transitional endoplasmic reticulum ATPase
5	9606.ENSP00000266025	0.835	Transmembrane protein 115
6	9606.ENSP00000158771	0.767	Derlin-2
7	9606.ENSP00000006777	0.747	Rhomboid domain containing 2
8	9606.ENSP00000379457	0.745	FAS-associated factor 1
9	9606.ENSP00000216085	0.714	Rhomboid domain containing 3
10	9606.ENSP00000366748	0.697	AUP1, lipid droplet regulating VLDL assembly factor
11	9606.ENSP00000366395	0.694	E3 ubiquitin-protein ligase synoviolin
12	9606.ENSP00000448182	0.688	TBC1 domain family member 15
13	9606.ENSP00000434727	0.681	Coiled-coil domain containing 180
14	9606.ENSP00000336994	0.675	Cleft lip and palate transmembrane protein 1
15	9606.ENSP00000221543	0.654	TBC1 domain family member 17
16	9606.ENSP00000220853	0.643	ER membrane protein complex subunit 2
17	9606.ENSP00000262316	0.612	Inactive rhomboid protein 1
18	9606.ENSP00000344206	0.608	Rhomboid-related protein 1
19	9606.ENSP00000441543	0.598	Polyubiquitin-C
20	9606.ENSP00000245046	0.595	ER membrane protein complex subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.477	catalytic activity
GO:0140096	0.368	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048523	0.986	negative regulation of cellular process
GO:0009987	0.984	cellular process
GO:0009968	0.980	negative regulation of signal transduction
GO:0060828	0.975	regulation of canonical Wnt signaling pathway
GO:0030178	0.973	negative regulation of Wnt signaling pathway
GO:0090090	0.930	negative regulation of canonical Wnt signaling pathway
GO:0008104	0.679	protein localization
GO:0071704	0.648	organic substance metabolic process
GO:0044238	0.628	primary metabolic process
GO:0006807	0.609	nitrogen compound metabolic process
GO:0050896	0.473	response to stimulus
GO:0033365	0.449	protein localization to organelle
GO:0043170	0.429	macromolecule metabolic process
GO:0019538	0.418	protein metabolic process
GO:0044237	0.401	cellular metabolic process
GO:0060341	0.398	regulation of cellular localization
GO:0051716	0.364	cellular response to stimulus
GO:0033157	0.362	regulation of intracellular protein transport
GO:0051224	0.342	negative regulation of protein transport
GO:0006508	0.318	proteolysis
GO:0034976	0.303	response to endoplasmic reticulum stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.975	membrane
GO:0031090	0.832	organelle membrane
GO:0032991	0.557	protein-containing complex
GO:0005829	0.447	cytosol
GO:0031984	0.374	organelle subcompartment
GO:0070013	0.335	intracellular organelle lumen
GO:0098827	0.320	endoplasmic reticulum subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]