StarFunc result for job id Q8NBP7

User Input

>input (692 residues)
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGT
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLP
GFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV
EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA
CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD
LFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA
KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP
PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRD
VSTTGSTSEGAVTAVAICCRSRHLAQASQELQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80W65	0.756	0.754	0.000	694	0.767	0.765	Q80W65.pdb.gz	PCSK9_MOUSE Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus OX=10090 GN=Pcsk9 PE=1 SV=2
2	AFDB:Q8NBP7	1.000	1.000	0.000	692	1.000	1.000	Q8NBP7.pdb.gz	PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 OS=Homo sapiens OX=9606 GN=PCSK9 PE=1 SV=3
3	PDB:6u3xB	0.682	0.966	3.710E-88	486	0.699	0.996	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
4	AFDB:E7F2J6	0.684	0.710	5.414E-81	667	0.497	0.516	E7F2J6.pdb.gz	E7F2J6_DANRE Proprotein convertase subtilisin/kexin type 9 OS=Danio rerio OX=7955 GN=pcsk9 PE=3 SV=1
5	AFDB:Q9K3X9	0.364	0.464	9.122E-35	537	0.211	0.272	Q9K3X9.pdb.gz	Q9K3X9_STRCO Secreted serine protease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1355 PE=1 SV=1
6	AFDB:Q9UTS0	0.358	0.542	4.343E-28	451	0.185	0.284	Q9UTS0.pdb.gz	PSP3_SCHPO Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psp3 PE=2 SV=1
7	AFDB:P09232	0.354	0.384	6.838E-28	635	0.191	0.208	P09232.pdb.gz	PRTB_YEAST Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRB1 PE=1 SV=1
8	AFDB:P40903	0.360	0.526	1.206E-27	467	0.184	0.272	P40903.pdb.gz	ISP6_SCHPO Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isp6 PE=2 SV=1
9	AFDB:P25036	0.357	0.508	9.842E-27	478	0.185	0.268	P25036.pdb.gz	YSP3_YEAST Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSP3 PE=2 SV=2
10	AFDB:P87184	0.346	0.478	2.305E-26	495	0.189	0.265	P87184.pdb.gz	ALP2_ASPFU Alkaline protease 2 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=alp2 PE=1 SV=1
11	AFDB:P9WEW3	0.357	0.606	3.841E-26	398	0.168	0.291	P9WEW3.pdb.gz	PCH13_PENRB Subtilisin-like serine protease Pen ch 13 OS=Penicillium rubens OX=1108849 PE=1 SV=1
12	PDB:3wivC	0.395	0.664	6.621E-18	397	0.126	0.219	3wivC.pdb.gz	Requirement of the insertion sequence for activation of Tk-subtilisin
13	PDB:1r6vA	0.423	0.435	1.418E-16	671	0.139	0.143	1r6vA.pdb.gz	Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
14	PDB:6u26A	0.131	0.984	3.400E-15	92	0.132	0.989	6u26A.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
15	PDB:2x8jD	0.324	0.686	4.964E-11	308	0.104	0.234	2x8jD.pdb.gz
16	PDB:3edyA	0.325	0.396	3.882E-7	544	0.103	0.131	3edyA.pdb.gz	Crystal Structure and Autoactivation Pathway of the Precursor Form of Human Tripeptidyl-peptidase 1, the Enzyme Deficient in Late Infantile Ceroid Lipofuscinosis
17	PDB:4nhyA	0.056	0.073	1.866E-2	461	0.035	0.052	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
18	PDB:2vvfA	0.102	0.216	4.129E-2	269	0.035	0.089	2vvfA.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
19	PDB:4lejA	0.089	0.135	5.483E-2	355	0.043	0.085	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.
20	PDB:3b7rL	0.055	0.061	1.147E-1	610	0.033	0.038	3b7rL.pdb.gz	Structure-based dissection of the active site chemistry of leukotriene a4 hydrolase: implications for m1 aminopeptidases and inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F2J6	0.0	659	667	0.499	0.517	E7F2J6_DANRE Proprotein convertase subtilisin/kexin type 9 OS=Danio rerio OX=7955 GN=pcsk9 PE=3 SV=1
2	P59996	0.0	1027	691	0.767	0.768	PCSK9_RAT Proprotein convertase subtilisin/kexin type 9 OS=Rattus norvegicus OX=10116 GN=Pcsk9 PE=1 SV=1
3	Q80W65	0.0	1027	694	0.746	0.744	PCSK9_MOUSE Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus OX=10090 GN=Pcsk9 PE=1 SV=2
4	Q8NBP7	0.0	1416	692	1.000	1.000	PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 OS=Homo sapiens OX=9606 GN=PCSK9 PE=1 SV=3
5	P87184	1.14e-47	177	495	0.192	0.269	ALP2_ASPFU Alkaline protease 2 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=alp2 PE=1 SV=1
6	Q9K3X9	4.38e-46	174	537	0.179	0.231	Q9K3X9_STRCO Secreted serine protease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1355 PE=1 SV=1
7	P25036	7.40e-41	158	478	0.172	0.249	YSP3_YEAST Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSP3 PE=2 SV=2
8	P09232	1.44e-40	159	635	0.162	0.176	PRTB_YEAST Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRB1 PE=1 SV=1
9	P40903	4.38e-40	155	467	0.149	0.221	ISP6_SCHPO Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isp6 PE=2 SV=1
10	Q9UTS0	1.11e-38	151	451	0.172	0.264	PSP3_SCHPO Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psp3 PE=2 SV=1
11	Q6FXI6	2.71e-38	150	468	0.169	0.250	Q6FXI6_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0B03619g PE=3 SV=1
12	B7ZK61	1.65e-37	149	518	0.160	0.214	CH901_DAVTA Subtilisin-like serine protease Cla h 9.0101 OS=Davidiella tassiana OX=29918 PE=1 SV=1
13	P12547	1.82e-34	138	403	0.159	0.273	ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alp1 PE=1 SV=2
14	P9WEW3	1.14e-32	132	398	0.145	0.251	PCH13_PENRB Subtilisin-like serine protease Pen ch 13 OS=Penicillium rubens OX=1108849 PE=1 SV=1
15	Q9Y749	1.19e-31	129	397	0.158	0.275	PENC1_PENCI Subtilisin-like serine protease Pen c 1 OS=Penicillium citrinum OX=5077 PE=1 SV=1
16	P25381	8.51e-30	125	491	0.149	0.210	RRT12_YEAST Subtilase-type proteinase RRT12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRT12 PE=1 SV=1
17	Q00208	1.45e-28	120	403	0.149	0.256	ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alp1 PE=2 SV=1
18	P28296	2.21e-27	117	403	0.147	0.253	ORYZ_ASPFU Alkaline protease 1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=alp1 PE=1 SV=2
19	P00782	3.04e-21	98.6	382	0.136	0.246	SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens OX=1390 GN=apr PE=1 SV=1
20	P58502	2.60e-18	90.1	422	0.139	0.227	TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1675 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05922 Inhibitor_I9	0.0029	29.5	Peptidase inhibitor I9
2	PF18459 PCSK9_C1	9.2e-41	149.2	Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
3	PF18464 PCSK9_C2	2e-29	112.6	Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
4	PF18463 PCSK9_C3	3e-30	115.5	Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
5	PF00082 Peptidase_S8	8.3e-26	102.5	Subtilase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303208

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454071	0.999	Low-density lipoprotein receptor
2	9606.ENSP00000265171	0.989	Pro-epidermal growth factor
3	9606.ENSP00000371532	0.961	Very low-density lipoprotein receptor
4	9606.ENSP00000233242	0.959	Apolipoprotein B-100
5	9606.ENSP00000346032	0.944	Annexin A2
6	9606.ENSP00000256637	0.923	Sortilin
7	9606.ENSP00000363458	0.835	Low density lipoprotein receptor adapter protein 1
8	9606.ENSP00000263574	0.785	Amyloid-like protein 2
9	9606.ENSP00000448165	0.781	Apoptotic protease-activating factor 1
10	9606.ENSP00000200676	0.763	Cholesteryl ester transfer protein
11	9606.ENSP00000287936	0.757	3-hydroxy-3-methylglutaryl-coenzyme A reductase
12	9606.ENSP00000354476	0.757	Sterol regulatory element-binding protein 2
13	9606.ENSP00000325917	0.749	Proprotein convertase subtilisin/kexin type 7
14	9606.ENSP00000289547	0.736	Niemann-Pick C1-like protein 1
15	9606.ENSP00000446280	0.732	Proprotein convertase subtilisin/kexin type 5
16	9606.ENSP00000303634	0.730	Low-density lipoprotein receptor-related protein 8
17	9606.ENSP00000275493	0.729	Epidermal growth factor receptor
18	9606.ENSP00000360170	0.718	Angiopoietin-related protein 3
19	9606.ENSP00000252486	0.711	Apolipoprotein E
20	9606.ENSP00000227667	0.710	Apolipoprotein C-III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	0.999	serine-type endopeptidase activity
GO:0050750	0.995	low-density lipoprotein particle receptor binding
GO:0097159	0.923	organic cyclic compound binding
GO:1901363	0.863	heterocyclic compound binding
GO:0098772	0.811	molecular function regulator activity
GO:0016247	0.749	channel regulator activity
GO:0099106	0.724	ion channel regulator activity
GO:0003676	0.715	nucleic acid binding
GO:0016248	0.714	channel inhibitor activity
GO:0017080	0.694	sodium channel regulator activity
GO:0008200	0.688	ion channel inhibitor activity
GO:0019871	0.675	sodium channel inhibitor activity
GO:0030545	0.646	signaling receptor regulator activity
GO:0030547	0.634	signaling receptor inhibitor activity
GO:0003723	0.621	RNA binding
GO:0043621	0.578	protein self-association
GO:0070326	0.407	very-low-density lipoprotein particle receptor binding
GO:0034190	0.373	apolipoprotein receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0009987	0.990	cellular process
GO:0048518	0.981	positive regulation of biological process
GO:0019222	0.976	regulation of metabolic process
GO:1901564	0.969	organonitrogen compound metabolic process
GO:0010941	0.965	regulation of cell death
GO:0080090	0.962	regulation of primary metabolic process
GO:0048522	0.962	positive regulation of cellular process
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0043170	0.947	macromolecule metabolic process
GO:0051246	0.942	regulation of protein metabolic process
GO:0019538	0.942	protein metabolic process
GO:0042592	0.927	homeostatic process
GO:0044237	0.919	cellular metabolic process
GO:0043067	0.905	regulation of programmed cell death
GO:0048878	0.870	chemical homeostasis
GO:0055088	0.864	lipid homeostasis
GO:1901214	0.860	regulation of neuron death
GO:0042981	0.860	regulation of apoptotic process
GO:0048519	0.852	negative regulation of biological process
GO:0031323	0.840	regulation of cellular metabolic process
GO:0055092	0.835	sterol homeostasis
GO:0009894	0.834	regulation of catabolic process
GO:0048523	0.821	negative regulation of cellular process
GO:1905952	0.816	regulation of lipid localization
GO:0006508	0.807	proteolysis
GO:0051604	0.805	protein maturation
GO:0051049	0.802	regulation of transport
GO:0050896	0.793	response to stimulus
GO:0016485	0.792	protein processing
GO:0065009	0.779	regulation of molecular function
GO:0051128	0.760	regulation of cellular component organization
GO:0023051	0.733	regulation of signaling
GO:0010646	0.725	regulation of cell communication
GO:0032368	0.723	regulation of lipid transport
GO:0032371	0.706	regulation of sterol transport
GO:0032374	0.665	regulation of cholesterol transport
GO:0030100	0.647	regulation of endocytosis
GO:0044092	0.642	negative regulation of molecular function
GO:0043112	0.628	receptor metabolic process
GO:0016540	0.617	protein autoprocessing
GO:0051179	0.614	localization
GO:0042632	0.613	cholesterol homeostasis
GO:0032501	0.609	multicellular organismal process
GO:0009893	0.607	positive regulation of metabolic process
GO:0051051	0.593	negative regulation of transport
GO:0043523	0.592	regulation of neuron apoptotic process
GO:0032409	0.552	regulation of transporter activity
GO:0034762	0.530	regulation of transmembrane transport
GO:0048583	0.515	regulation of response to stimulus
GO:0009966	0.497	regulation of signal transduction
GO:0051050	0.495	positive regulation of transport
GO:0051234	0.488	establishment of localization
GO:0006810	0.481	transport
GO:0051716	0.478	cellular response to stimulus
GO:0043269	0.478	regulation of monoatomic ion transport
GO:0010604	0.472	positive regulation of macromolecule metabolic process
GO:0034763	0.470	negative regulation of transmembrane transport
GO:0043271	0.469	negative regulation of monoatomic ion transport
GO:0032410	0.469	negative regulation of transporter activity
GO:0022898	0.466	regulation of transmembrane transporter activity
GO:0032502	0.459	developmental process
GO:0034766	0.459	negative regulation of monoatomic ion transmembrane transport
GO:0048259	0.452	regulation of receptor-mediated endocytosis
GO:0032412	0.445	regulation of monoatomic ion transmembrane transporter activity
GO:0060341	0.406	regulation of cellular localization
GO:0007154	0.392	cell communication
GO:1905953	0.365	negative regulation of lipid localization
GO:0010942	0.363	positive regulation of cell death
GO:0051173	0.360	positive regulation of nitrogen compound metabolic process
GO:0051129	0.359	negative regulation of cellular component organization
GO:0048856	0.358	anatomical structure development
GO:0031325	0.340	positive regulation of cellular metabolic process
GO:0032369	0.328	negative regulation of lipid transport
GO:0043065	0.313	positive regulation of apoptotic process
GO:0042176	0.302	regulation of protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0005615	0.998	extracellular space
GO:0070013	0.997	intracellular organelle lumen
GO:0016020	0.993	membrane
GO:0031410	0.986	cytoplasmic vesicle
GO:0031090	0.942	organelle membrane
GO:0071944	0.934	cell periphery
GO:0098588	0.933	bounding membrane of organelle
GO:0005788	0.879	endoplasmic reticulum lumen
GO:0005886	0.786	plasma membrane
GO:0005794	0.748	Golgi apparatus
GO:0000323	0.744	lytic vacuole
GO:0005768	0.728	endosome
GO:0005764	0.711	lysosome
GO:0005634	0.680	nucleus
GO:0030659	0.640	cytoplasmic vesicle membrane
GO:0098852	0.557	lytic vacuole membrane
GO:0005765	0.539	lysosomal membrane
GO:0031981	0.534	nuclear lumen
GO:0010008	0.529	endosome membrane
GO:0098552	0.476	side of membrane
GO:0032991	0.467	protein-containing complex
GO:0048471	0.443	perinuclear region of cytoplasm
GO:0009897	0.440	external side of plasma membrane
GO:0005770	0.438	late endosome
GO:0019897	0.435	extrinsic component of plasma membrane
GO:0005654	0.420	nucleoplasm
GO:0005769	0.405	early endosome
GO:1903561	0.395	extracellular vesicle
GO:0036020	0.393	endolysosome membrane
GO:0070062	0.389	extracellular exosome
GO:1990667	0.351	PCSK9-AnxA2 complex
GO:1990666	0.351	PCSK9-LDLR complex
GO:0031232	0.346	extrinsic component of external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	0.999	Serine endopeptidases.

[back to server]