StarFunc result for job id Q8NBS9

User Input

>input (432 residues)
MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDP
HSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVD
CTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVE
PPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETV
KIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG
ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTW
EELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL
HRFVLSQAKDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NBS9	1.000	1.000	8.673E-90	432	1.000	1.000	Q8NBS9.pdb.gz	TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2
2	AFDB:Q91W90	0.702	0.724	8.581E-77	417	0.838	0.868	Q91W90.pdb.gz	TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus OX=10090 GN=Txndc5 PE=1 SV=2
3	AFDB:Q9VYV3	0.303	0.311	9.213E-45	416	0.391	0.406	Q9VYV3.pdb.gz	TXND5_DROME Thioredoxin domain-containing protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=prtp PE=1 SV=2
4	AFDB:Q960C0	0.317	0.279	6.648E-31	510	0.227	0.192	Q960C0.pdb.gz	Q960C0_DROME SD08104p OS=Drosophila melanogaster OX=7227 GN=CG9302 PE=2 SV=1
5	AFDB:A8WG75	0.307	0.266	2.184E-29	528	0.215	0.176	A8WG75.pdb.gz	A8WG75_DANRE Pdia5 protein OS=Danio rerio OX=7955 GN=zgc:172235 PE=1 SV=1
6	AFDB:Q9MAU6	0.266	0.258	2.738E-28	447	0.241	0.233	Q9MAU6.pdb.gz	PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-2 PE=2 SV=2
7	AFDB:Q9XWE1	0.264	0.166	4.432E-28	788	0.211	0.115	Q9XWE1.pdb.gz	Q9XWE1_CAEEL DnaJ homolog subfamily C member 10 OS=Caenorhabditis elegans OX=6239 GN=dnj-27 PE=1 SV=1
8	AFDB:Q14554	0.383	0.337	5.310E-28	519	0.211	0.175	Q14554.pdb.gz	PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens OX=9606 GN=PDIA5 PE=1 SV=1
9	AFDB:O48773	0.314	0.310	4.112E-27	440	0.220	0.216	O48773.pdb.gz	PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-3 PE=2 SV=1
10	AFDB:Q67UF5	0.266	0.261	6.268E-27	441	0.229	0.224	Q67UF5.pdb.gz	PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL2-3 PE=2 SV=1
11	PDB:3apoA	0.238	0.159	7.076E-23	688	0.171	0.108	3apoA.pdb.gz
12	PDB:4ekzA	0.268	0.250	5.481E-22	469	0.250	0.230	4ekzA.pdb.gz
13	PDB:3f8uA	0.258	0.245	1.695E-20	469	0.245	0.226	3f8uA.pdb.gz
14	PDB:5gu6A	0.226	0.257	6.100E-17	377	0.141	0.162	5gu6A.pdb.gz
15	PDB:2r2jA	0.225	0.293	2.260E-15	328	0.137	0.180	2r2jA.pdb.gz
16	PDB:5crgA	0.212	0.255	2.512E-14	354	0.111	0.136	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
17	PDB:7f05C	0.212	0.254	3.345E-13	355	0.106	0.130	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
18	PDB:3ed3A	0.230	0.367	2.880E-11	267	0.106	0.172	3ed3A.pdb.gz
19	PDB:6yt3B	0.240	0.274	5.423E-9	376	0.067	0.077	6yt3B.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
20	PDB:4f9zA	0.226	0.418	8.778E-9	219	0.074	0.146	4f9zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86UY0	0.0	718	360	0.796	0.956	Q86UY0_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=1
2	Q8NBS9	0.0	896	432	1.000	1.000	TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2
3	Q91W90	0.0	719	417	0.829	0.859	TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus OX=10090 GN=Txndc5 PE=1 SV=2
4	Q9VYV3	1.87e-106	323	416	0.384	0.399	TXND5_DROME Thioredoxin domain-containing protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=prtp PE=1 SV=2
5	O22263	5.14e-45	162	361	0.211	0.252	PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-1 PE=2 SV=1
6	P34329	1.54e-42	160	618	0.204	0.142	PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2
7	Q9VJZ1	7.63e-42	156	510	0.252	0.214	Q9VJZ1_DROME FI21342p1 OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.80 PE=1 SV=1
8	Q960C0	7.79e-42	156	510	0.252	0.214	Q960C0_DROME SD08104p OS=Drosophila melanogaster OX=7227 GN=CG9302 PE=2 SV=1
9	Q86IA3	2.79e-40	149	363	0.218	0.259	PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum OX=44689 GN=pdi1 PE=1 SV=2
10	O48773	1.13e-38	146	440	0.201	0.198	PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-3 PE=2 SV=1
11	Q9MAU6	1.24e-38	147	447	0.208	0.201	PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-2 PE=2 SV=2
12	Q67UF5	3.56e-38	145	441	0.190	0.186	PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL2-3 PE=2 SV=1
13	A0A384NPU5	1.63e-37	143	440	0.183	0.180	A0A384NPU5_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q15084	1.63e-37	143	440	0.183	0.180	PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1
15	P08003	6.66e-37	144	638	0.199	0.135	PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus OX=10090 GN=Pdia4 PE=1 SV=3
16	P13667	9.25e-37	144	645	0.201	0.135	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
17	P38659	1.98e-36	143	643	0.199	0.134	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
18	Q00216	1.39e-35	136	359	0.201	0.242	TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger OX=5061 GN=tigA PE=2 SV=1
19	Q63081	2.91e-35	137	440	0.181	0.177	PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus OX=10116 GN=Pdia6 PE=1 SV=2
20	Q922R8	3.22e-35	137	440	0.181	0.177	PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus OX=10090 GN=Pdia6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07449 HyaE	0.19	23.2	Hydrogenase-1 expression protein HyaE
2	PF04756 OST3_OST6	2.2e-05	35.6	OST3 / OST6 family, transporter family
3	PF00085 Thioredoxin	6.1e-83	284.9	Thioredoxin
4	PF13098 Thioredoxin_2	8e-12	56.9	Thioredoxin-like domain
5	PF13192 Thioredoxin_3	95	14.5	Thioredoxin domain
6	PF13899 Thioredoxin_7	0.0046	28.4	Thioredoxin-like
7	PF13905 Thioredoxin_8	0.0018	29.8	Thioredoxin-like
8	PF14595 Thioredoxin_9	3.9	18.7	Thioredoxin
9	PF13728 TraF	0.57	21.5	F plasmid transfer operon protein
10	PF13423 UCH_1	2.3e+02	12.8	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368646	0.974	Peroxiredoxin-4
2	9606.ENSP00000432083	0.959	Heat shock cognate 71 kDa protein
3	9606.ENSP00000217131	0.917	Cathepsin Z
4	9606.ENSP00000258145	0.906	N-acetylglucosamine-6-sulfatase
5	9606.ENSP00000360108	0.906	Putative tyrosine-protein phosphatase auxilin
6	9606.ENSP00000222219	0.900	Deoxyribonuclease-2-alpha
7	9606.ENSP00000379042	0.875	ERO1-like protein alpha
8	9606.ENSP00000346635	0.860	ERO1-like protein beta
9	9606.ENSP00000341680	0.816	Dysbindin
10	9606.ENSP00000263354	0.805	Alpha-soluble NSF attachment protein
11	9606.ENSP00000442453	0.801	BLOC1S5-TXNDC5 readthrough
12	9606.ENSP00000220531	0.800	Biogenesis of lysosome-related organelles complex 1 subunit 6
13	9606.ENSP00000318128	0.800	Biogenesis of lysosome-related organelles complex 1 subunit 4
14	9606.ENSP00000393840	0.800	Biogenesis of lysosome-related organelles complex 1 subunit 3
15	9606.ENSP00000301522	0.705	Peroxiredoxin-2
16	9606.ENSP00000341785	0.698	Adiponectin receptor protein 1
17	9606.ENSP00000299767	0.697	Endoplasmin
18	9606.ENSP00000480150	0.687	Hypoxia up-regulated protein 1
19	9606.ENSP00000434516	0.662	Thioredoxin reductase 1, cytoplasmic
20	9606.ENSP00000440005	0.648	ADP-ribosylation factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016667	0.997	oxidoreductase activity, acting on a sulfur group of donors
GO:0140096	0.991	catalytic activity, acting on a protein
GO:0015036	0.987	disulfide oxidoreductase activity
GO:0016853	0.853	isomerase activity
GO:0015035	0.839	protein-disulfide reductase activity
GO:0016860	0.808	intramolecular oxidoreductase activity
GO:0016864	0.724	intramolecular oxidoreductase activity, transposing S-S bonds
GO:0003756	0.415	protein disulfide isomerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0050794	0.946	regulation of cellular process
GO:0009987	0.872	cellular process
GO:0048519	0.815	negative regulation of biological process
GO:0048523	0.810	negative regulation of cellular process
GO:0042981	0.778	regulation of apoptotic process
GO:0060548	0.634	negative regulation of cell death
GO:0043069	0.588	negative regulation of programmed cell death
GO:0043066	0.582	negative regulation of apoptotic process
GO:0008152	0.412	metabolic process
GO:0071704	0.340	organic substance metabolic process
GO:0006807	0.300	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0070013	0.997	intracellular organelle lumen
GO:0031982	0.868	vesicle
GO:0005576	0.837	extracellular region
GO:0016020	0.831	membrane
GO:0005615	0.777	extracellular space
GO:0005788	0.753	endoplasmic reticulum lumen
GO:1903561	0.752	extracellular vesicle
GO:0097708	0.719	intracellular vesicle
GO:0070062	0.706	extracellular exosome
GO:0031410	0.705	cytoplasmic vesicle
GO:0005764	0.630	lysosome
GO:0005829	0.386	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	0.997	Acting on a sulfur group of donors.
EC:5.-.-.-	0.853	Isomerases.
EC:5.3.-.-	0.808	Intramolecular oxidoreductases.
EC:5.3.4.-	0.724	Transposing S-S bonds.
EC:5.3.4.1	0.415	protein disulfide-isomerase.

[back to server]