StarFunc result for job id Q8NBW4

User Input

>input (561 residues)
MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDH
ASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSL
VTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDT
TSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHIND
TDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLL
PLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFP
QLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPL
SKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFH
VLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPK
LIFHVFIIILGVANLIVQFFM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NBW4	1.000	1.000	1.731E-80	561	1.000	1.000	Q8NBW4.pdb.gz	S38A9_HUMAN Neutral amino acid transporter 9 OS=Homo sapiens OX=9606 GN=SLC38A9 PE=1 SV=2
2	AFDB:Q08BA4	0.789	0.806	2.007E-55	549	0.620	0.634	Q08BA4.pdb.gz	S38A9_DANRE Neutral amino acid transporter 9 OS=Danio rerio OX=7955 GN=slc38a9 PE=1 SV=1
3	PDB:7kgvB	0.665	0.917	2.841E-34	404	0.503	0.698	7kgvB.pdb.gz
4	PDB:7kgvA	0.599	0.918	6.137E-30	361	0.474	0.737	7kgvA.pdb.gz
5	AFDB:A2VCW5	0.610	0.708	1.327E-15	479	0.148	0.173	A2VCW5.pdb.gz	S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus OX=10116 GN=Slc38a5 PE=1 SV=1
6	AFDB:A0A024R0W3	0.637	0.702	6.902E-15	506	0.144	0.160	A0A024R0W3.pdb.gz
7	AFDB:Q8WUX1	0.617	0.727	7.208E-15	472	0.150	0.178	Q8WUX1.pdb.gz	S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC38A5 PE=1 SV=1
8	AFDB:Q9H2H9	0.623	0.713	1.020E-14	487	0.155	0.179	Q9H2H9.pdb.gz	S38A1_HUMAN Sodium-coupled neutral amino acid symporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1
9	AFDB:Q8CH36	0.625	0.698	1.574E-14	500	0.144	0.162	Q8CH36.pdb.gz	S36A4_MOUSE Neutral amino acid uniporter 4 OS=Mus musculus OX=10090 GN=Slc36a4 PE=1 SV=1
10	AFDB:Q8K415	0.608	0.704	1.872E-14	481	0.150	0.175	Q8K415.pdb.gz	S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc36a2 PE=1 SV=1
11	AFDB:P39981	0.612	0.710	3.152E-14	480	0.127	0.148	P39981.pdb.gz	AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT2 PE=2 SV=1
12	AFDB:Q5I012	0.587	0.310	3.749E-14	1090	0.143	0.073	Q5I012.pdb.gz	S38AA_MOUSE Solute carrier family 38 member 10 OS=Mus musculus OX=10090 GN=Slc38a10 PE=1 SV=2
13	PDB:7p9uB	0.509	0.611	2.747E-6	455	0.098	0.121	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
14	PDB:7cmhB	0.482	0.576	7.783E-6	458	0.105	0.129	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
15	PDB:7dskB	0.476	0.558	2.205E-5	464	0.112	0.136	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
16	PDB:6jmqA	0.489	0.652	4.611E-5	403	0.109	0.151	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
17	PDB:7s1xB	0.387	0.273	5.252E-5	871	0.144	0.093	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:7ccsB	0.502	0.605	2.297E-4	454	0.103	0.128	7ccsB.pdb.gz
19	PDB:6li9B	0.502	0.601	2.980E-4	458	0.111	0.135	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
20	PDB:6vrhA	0.433	0.446	3.112E-4	541	0.111	0.115	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08BA4	0.0	704	549	0.613	0.627	S38A9_DANRE Neutral amino acid transporter 9 OS=Danio rerio OX=7955 GN=slc38a9 PE=1 SV=1
2	Q8NBW4	0.0	1154	561	1.000	1.000	S38A9_HUMAN Neutral amino acid transporter 9 OS=Homo sapiens OX=9606 GN=SLC38A9 PE=1 SV=2
3	Q9LI61	1.57e-06	53.1	460	0.168	0.204	AVT6A_ARATH Amino acid transporter AVT6A OS=Arabidopsis thaliana OX=3702 GN=AVT6A PE=2 SV=1
4	Q8BWH0	1.65e-06	53.1	463	0.171	0.207	S38A7_MOUSE Sodium-coupled neutral amino acid transporter 7 OS=Mus musculus OX=10090 GN=Slc38a7 PE=1 SV=1
5	Q8IZM9	2.53e-06	52.4	456	0.105	0.129	S38A6_HUMAN Solute carrier family 38 member 6 OS=Homo sapiens OX=9606 GN=SLC38A6 PE=1 SV=2
6	G3UVW3	2.78e-06	52.4	457	0.100	0.123	S38A6_MOUSE Solute carrier family 38 member 6 OS=Mus musculus OX=10090 GN=Slc38a6 PE=1 SV=1
7	Q9NVC3	2.04e-04	46.6	462	0.082	0.100	S38A7_HUMAN Sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens OX=9606 GN=SLC38A7 PE=1 SV=1
8	P39981	2.44e-04	46.2	480	0.159	0.185	AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT2 PE=2 SV=1
9	O80668	5.15e-04	45.1	536	0.048	0.050	AVT1A_ARATH Amino acid transporter AVT1A OS=Arabidopsis thaliana OX=3702 GN=AVT1A PE=2 SV=2
10	Q99624	0.001	43.9	504	0.173	0.192	S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC38A3 PE=1 SV=1
11	P47082	0.002	43.5	602	0.061	0.056	AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT1 PE=1 SV=1
12	Q85V22	0.002	43.5	441	0.048	0.061	Q85V22_ORYSI Histidine amino acid transporter OS=Oryza sativa subsp. indica OX=39946 GN=ht PE=4 SV=1
13	Q9M8L9	0.006	42.0	489	0.053	0.061	AVT6E_ARATH Amino acid transporter AVT6E OS=Arabidopsis thaliana OX=3702 GN=AVT6E PE=2 SV=1
14	Q8K415	0.007	41.6	481	0.064	0.075	S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc36a2 PE=1 SV=1
15	Q495M3	0.008	41.6	483	0.075	0.087	S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC36A2 PE=1 SV=1
16	Q9SF09	0.020	40.0	432	0.050	0.065	ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana OX=3702 GN=ANT1 PE=1 SV=1
17	P0AAD4	0.021	40.0	403	0.053	0.074	TYRP_ECOLI Tyrosine-specific transport system OS=Escherichia coli (strain K12) OX=83333 GN=tyrP PE=1 SV=1
18	Q9FKS8	0.025	39.7	446	0.046	0.058	LHT1_ARATH Lysine histidine transporter 1 OS=Arabidopsis thaliana OX=3702 GN=LHT1 PE=1 SV=1
19	Q8BHK3	0.026	39.7	478	0.062	0.073	S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc36a2 PE=1 SV=1
20	Q38AV6	0.033	39.3	453	0.180	0.223	Q38AV6_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0300 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	1.5e-24	98.2	Transmembrane amino acid transporter protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380074

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256644	0.999	Ragulator complex protein LAMTOR5
2	9606.ENSP00000278671	0.999	Ragulator complex protein LAMTOR1
3	9606.ENSP00000343118	0.999	Ragulator complex protein LAMTOR4
4	9606.ENSP00000357288	0.999	Ragulator complex protein LAMTOR2
5	9606.ENSP00000362092	0.999	Ras-related GTP-binding protein C
6	9606.ENSP00000369899	0.999	Ras-related GTP-binding protein A
7	9606.ENSP00000262850	0.998	Ras-related GTP-binding protein B
8	9606.ENSP00000424183	0.998	Ragulator complex protein LAMTOR3
9	9606.ENSP00000358423	0.988	Ras-related GTP-binding protein D
10	9606.ENSP00000219476	0.947	Tuberin
11	9606.ENSP00000225577	0.941	Ribosomal protein S6 kinase beta-1
12	9606.ENSP00000340691	0.933	Eukaryotic translation initiation factor 4E-binding protein 1
13	9606.ENSP00000298552	0.931	Hamartin
14	9606.ENSP00000425561	0.923	Eukaryotic translation initiation factor 4E
15	9606.ENSP00000451828	0.922	RAC-alpha serine/threonine-protein kinase
16	9606.ENSP00000386862	0.917	SH3 domain-binding protein 4
17	9606.ENSP00000229328	0.907	5'-AMP-activated protein kinase subunit beta-1
18	9606.ENSP00000254101	0.907	5'-AMP-activated protein kinase subunit beta-2
19	9606.ENSP00000287878	0.906	5'-AMP-activated protein kinase subunit gamma-2
20	9606.ENSP00000323867	0.906	5'-AMP-activated protein kinase subunit gamma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140299	0.999	small molecule sensor activity
GO:0036094	0.999	small molecule binding
GO:0015658	0.999	branched-chain amino acid transmembrane transporter activity
GO:0015179	0.999	L-amino acid transmembrane transporter activity
GO:0015175	0.999	neutral L-amino acid transmembrane transporter activity
GO:0005515	0.992	protein binding
GO:0015186	0.970	L-glutamine transmembrane transporter activity
GO:0015174	0.942	basic amino acid transmembrane transporter activity
GO:0015190	0.940	L-leucine transmembrane transporter activity
GO:0072349	0.918	modified amino acid transmembrane transporter activity
GO:0061459	0.899	L-arginine transmembrane transporter activity
GO:0098772	0.891	molecular function regulator activity
GO:0042887	0.864	amide transmembrane transporter activity
GO:0032934	0.850	sterol binding
GO:0030234	0.839	enzyme regulator activity
GO:0015485	0.838	cholesterol binding
GO:0140677	0.785	molecular function activator activity
GO:0060589	0.745	nucleoside-triphosphatase regulator activity
GO:0030695	0.732	GTPase regulator activity
GO:0140678	0.655	molecular function inhibitor activity
GO:0015182	0.633	L-asparagine transmembrane transporter activity
GO:0005085	0.588	guanyl-nucleotide exchange factor activity
GO:0022804	0.531	active transmembrane transporter activity
GO:0015075	0.497	monoatomic ion transmembrane transporter activity
GO:0015318	0.495	inorganic molecular entity transmembrane transporter activity
GO:0022853	0.479	active monoatomic ion transmembrane transporter activity
GO:0008324	0.471	monoatomic cation transmembrane transporter activity
GO:0022890	0.463	inorganic cation transmembrane transporter activity
GO:0032935	0.441	sterol sensor activity
GO:0015291	0.353	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0051179	0.979	localization
GO:0065007	0.977	biological regulation
GO:0050789	0.965	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0006810	0.929	transport
GO:0050896	0.922	response to stimulus
GO:0015804	0.845	neutral amino acid transport
GO:0051716	0.841	cellular response to stimulus
GO:0048518	0.799	positive regulation of biological process
GO:0048583	0.783	regulation of response to stimulus
GO:0009966	0.740	regulation of signal transduction
GO:0032006	0.731	regulation of TOR signaling
GO:0048522	0.693	positive regulation of cellular process
GO:0010243	0.635	response to organonitrogen compound
GO:0009967	0.607	positive regulation of signal transduction
GO:1902533	0.604	positive regulation of intracellular signal transduction
GO:0009719	0.555	response to endogenous stimulus
GO:0043200	0.538	response to amino acid
GO:0032008	0.521	positive regulation of TOR signaling
GO:0070887	0.515	cellular response to chemical stimulus
GO:0055085	0.513	transmembrane transport
GO:0071310	0.450	cellular response to organic substance
GO:0071495	0.448	cellular response to endogenous stimulus
GO:1901701	0.442	cellular response to oxygen-containing compound
GO:0071417	0.435	cellular response to organonitrogen compound
GO:0003333	0.435	amino acid transmembrane transport
GO:1903432	0.431	regulation of TORC1 signaling
GO:0071230	0.418	cellular response to amino acid stimulus
GO:0015807	0.374	L-amino acid transport
GO:1902475	0.322	L-alpha-amino acid transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.997	endomembrane system
GO:0031982	0.997	vesicle
GO:0140535	0.995	intracellular protein-containing complex
GO:0000323	0.995	lytic vacuole
GO:0005774	0.995	vacuolar membrane
GO:0005765	0.991	lysosomal membrane
GO:0005768	0.989	endosome
GO:0032045	0.985	guanyl-nucleotide exchange factor complex
GO:0098796	0.979	membrane protein complex
GO:0005770	0.941	late endosome
GO:0005829	0.783	cytosol
GO:0005886	0.608	plasma membrane
GO:0070062	0.349	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32143	0.899	L-arginine(in) = L-arginine(out)

[back to server]