StarFunc result for job id Q8NBZ7

User Input

>input (420 residues)
MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVE
PLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDN
FFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNT
IGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAET
MCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQ
YVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQK
RKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5PQX0	0.939	0.939	1.844E-83	420	0.981	0.981	Q5PQX0.pdb.gz	UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus OX=10116 GN=Uxs1 PE=1 SV=1
2	AFDB:Q6GMI9	0.956	0.960	3.891E-78	418	0.869	0.873	Q6GMI9.pdb.gz	UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio OX=7955 GN=uxs1 PE=1 SV=2
3	AFDB:G5EF65	0.789	0.711	1.371E-61	467	0.588	0.529	G5EF65.pdb.gz	G5EF65_CAEEL UDP-glucuronate decarboxylase OS=Caenorhabditis elegans OX=6239 GN=sqv-1 PE=1 SV=1
4	AFDB:Q8VZC0	0.752	0.726	6.463E-54	435	0.476	0.460	Q8VZC0.pdb.gz	UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
5	AFDB:Q9LZI2	0.743	0.702	4.339E-52	445	0.464	0.438	Q9LZI2.pdb.gz	UXS2_ARATH UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=UXS2 PE=1 SV=1
6	AFDB:C0Z2I3	0.740	0.693	1.006E-51	449	0.471	0.441	C0Z2I3.pdb.gz	C0Z2I3_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS4 PE=1 SV=1
7	AFDB:F4KHU8	0.731	0.858	5.750E-51	357	0.483	0.569	F4KHU8.pdb.gz	F4KHU8_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS3 PE=1 SV=1
8	AFDB:F4JAG3	0.737	0.676	6.757E-50	458	0.471	0.432	F4JAG3.pdb.gz	F4JAG3_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
9	AFDB:P9WN67	0.676	0.895	4.358E-30	314	0.212	0.283	P9WN67.pdb.gz	GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=galE1 PE=1 SV=1
10	PDB:6lttA	0.665	0.888	5.875E-30	311	0.212	0.286	6lttA.pdb.gz
11	AFDB:Q9LPG6	0.676	0.434	2.594E-28	667	0.221	0.139	Q9LPG6.pdb.gz	RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana OX=3702 GN=RHM2 PE=1 SV=1
12	PDB:1keuA	0.662	0.764	8.977E-27	361	0.190	0.222	1keuA.pdb.gz	Toward a structural understanding of the dehydratase mechanism.
13	PDB:2c59A	0.662	0.758	2.082E-26	364	0.200	0.231	2c59A.pdb.gz	Structure and Function of Gdp-Mannose-3',5'-Epimerase: An Enzyme which Performs Three Chemical Reactions at the Same Active Site.
14	PDB:1z7eD	0.650	0.431	1.190E-25	644	0.210	0.137	1z7eD.pdb.gz	Structure and Mechanism of ArnA: Conformational Change Implies Ordered Dehydrogenase Mechanism in Key Enzyme for Polymyxin Resistance
15	PDB:6h0nA	0.662	0.733	2.447E-25	377	0.229	0.255	6h0nA.pdb.gz	Deciphering the enzymatic mechanism of sugar ring contraction in UDP-apiose biosynthesis.
16	PDB:1bxkB	0.644	0.779	1.216E-23	344	0.198	0.241	1bxkB.pdb.gz	Molecular Structure of Dtdp-Glucose 4,6-Dehydratase from E. Coli
17	PDB:1bsvA	0.595	0.775	1.547E-23	317	0.181	0.240	1bsvA.pdb.gz	GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
18	PDB:2pk3A	0.606	0.808	1.744E-23	309	0.195	0.265	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
19	PDB:5in4A	0.657	0.768	2.089E-23	355	0.169	0.200	5in4A.pdb.gz	Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
20	PDB:6x3bA	0.588	0.805	1.346E-22	300	0.188	0.263	6x3bA.pdb.gz	X-ray crystallographic structure of RMD, the reductase involved in GDP-d-rhamnose production

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5PQX0	0.0	860	420	0.981	0.981	UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus OX=10116 GN=Uxs1 PE=1 SV=1
2	Q6GMI9	0.0	778	418	0.871	0.876	UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio OX=7955 GN=uxs1 PE=1 SV=2
3	Q8NBZ7	0.0	870	420	1.000	1.000	UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens OX=9606 GN=UXS1 PE=1 SV=1
4	Q91XL3	0.0	862	420	0.986	0.986	UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus OX=10090 GN=Uxs1 PE=1 SV=1
5	G5EF65	3.58e-180	512	467	0.555	0.499	G5EF65_CAEEL UDP-glucuronate decarboxylase OS=Caenorhabditis elegans OX=6239 GN=sqv-1 PE=1 SV=1
6	Q9ZV36	5.58e-146	420	343	0.471	0.577	UXS6_ARATH UDP-glucuronic acid decarboxylase 6 OS=Arabidopsis thaliana OX=3702 GN=UXS6 PE=2 SV=1
7	F4KHU8	1.41e-145	420	357	0.474	0.557	F4KHU8_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS3 PE=1 SV=1
8	Q9SN95	4.93e-145	418	341	0.474	0.584	UXS5_ARATH UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana OX=3702 GN=UXS5 PE=2 SV=1
9	Q8VZC0	1.09e-144	421	435	0.467	0.451	UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
10	Q9LZI2	1.79e-141	413	445	0.462	0.436	UXS2_ARATH UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=UXS2 PE=1 SV=1
11	C0Z2I3	1.05e-139	408	449	0.464	0.434	C0Z2I3_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS4 PE=1 SV=1
12	F4JAG3	5.58e-135	397	458	0.464	0.426	F4JAG3_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
13	P9WN67	1.65e-31	124	314	0.217	0.290	GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=galE1 PE=1 SV=1
14	Q9ZUY6	8.53e-30	121	389	0.255	0.275	AXS1_ARATH UDP-D-apiose/UDP-D-xylose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=AXS1 PE=1 SV=1
15	Q9SGE0	1.39e-29	120	389	0.252	0.272	AXS2_ARATH UDP-D-apiose/UDP-D-xylose synthase 2 OS=Arabidopsis thaliana OX=3702 GN=AXS2 PE=2 SV=1
16	P77398	2.62e-29	122	660	0.217	0.138	ARNA_ECOLI Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain K12) OX=83333 GN=arnA PE=1 SV=1
17	Q9LPG6	5.24e-29	121	667	0.229	0.144	RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana OX=3702 GN=RHM2 PE=1 SV=1
18	Q9LH76	1.09e-28	120	664	0.229	0.145	RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana OX=3702 GN=RHM3 PE=2 SV=1
19	O95455	5.97e-26	109	350	0.221	0.266	TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens OX=9606 GN=TGDS PE=1 SV=1
20	Q9SYM5	3.11e-25	110	669	0.219	0.138	RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana OX=3702 GN=RHM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	7.4e-05	33.5	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF01370 Epimerase	1.1e-46	170.8	NAD dependent epimerase/dehydratase family
3	PF16363 GDP_Man_Dehyd	3.4e-54	196.1	GDP-mannose 4,6 dehydratase
4	PF07993 NAD_binding_4	8.4e-07	40.0	Male sterility protein
5	PF02719 Polysacc_synt_2	0.00042	31.2	Polysaccharide biosynthesis protein
6	PF04321 RmlD_sub_bind	8.9e-07	39.8	RmlD substrate binding domain
7	PF11803 UXS1_N	2.3e-35	132.1	UDP-glucuronate decarboxylase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000013103

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012990	0.999	Involved in the biosynthesis of glycosaminoglycans
2	60711.ENSCSAP00000017632	0.896	Uncharacterized protein
3	60711.ENSCSAP00000010712	0.703	GDP-mannose pyrophosphorylase B
4	60711.ENSCSAP00000011314	0.674	Dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
5	60711.ENSCSAP00000008270	0.673	FAM20B, glycosaminoglycan xylosylkinase
6	60711.ENSCSAP00000008601	0.672	Solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
7	60711.ENSCSAP00000004222	0.669	Xylosyltransferase I
8	60711.ENSCSAP00000002911	0.655	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
9	60711.ENSCSAP00000001862	0.653	Belongs to the glycosyltransferase 47 family.
10	60711.ENSCSAP00000004086	0.653	RAP2C, member of RAS oncogene family
11	60711.ENSCSAP00000013271	0.653	Unc-50 inner nuclear membrane RNA binding protein
12	60711.ENSCSAP00000013551	0.653	RAP2A, member of RAS oncogene family
13	60711.ENSCSAP00000014083	0.649	A kinase (PRKA) anchor protein 17A
14	60711.ENSCSAP00000004976	0.648	Xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7
15	60711.ENSCSAP00000011980	0.643	Belongs to the glycosyltransferase 47 family.
16	60711.ENSCSAP00000000600	0.634	FAM20A, golgi associated secretory pathway pseudokinase
17	60711.ENSCSAP00000000978	0.632	Glucose-6-phosphate isomerase
18	60711.ENSCSAP00000019105	0.627	Proline rich 15
19	60711.ENSCSAP00000003458	0.620	Uncharacterized protein
20	60711.ENSCSAP00000006396	0.620	Galactose-1-phosphate uridylyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016831	1.000	carboxy-lyase activity
GO:0005488	0.935	binding
GO:0048040	0.805	UDP-glucuronate decarboxylase activity
GO:0005515	0.766	protein binding
GO:0043167	0.425	ion binding
GO:0097159	0.399	organic cyclic compound binding
GO:1901363	0.371	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.987	metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.974	primary metabolic process
GO:1901137	0.970	carbohydrate derivative biosynthetic process
GO:0044281	0.967	small molecule metabolic process
GO:0009225	0.955	nucleotide-sugar metabolic process
GO:0044249	0.874	cellular biosynthetic process
GO:0006793	0.860	phosphorus metabolic process
GO:0009226	0.686	nucleotide-sugar biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005576	0.954	extracellular region
GO:0005794	0.904	Golgi apparatus
GO:0016020	0.900	membrane
GO:0005615	0.897	extracellular space
GO:0031090	0.888	organelle membrane
GO:0031982	0.792	vesicle
GO:0070062	0.769	extracellular exosome
GO:0032991	0.706	protein-containing complex
GO:0005739	0.481	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.1.-	1.000	Carboxy-lyases.
RHEA:23916	0.805	H(+) + UDP-alpha-D-glucuronate = CO2 + UDP-alpha-D-xylose
EC:4.1.1.35	0.805	UDP-glucuronate decarboxylase.

[back to server]