StarFunc result for job id Q8NC24

User Input

>input (303 residues)
MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ
PPEDDDMNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH
HHTVHLGSAAPCLHCSRSKRPPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGL
HEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPERPQPQVLASPPVQNG
GLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEANGQPSKPDTSDHQVSLPQGA
GSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NC24	0.999	0.999	3.909E-48	303	1.000	1.000	Q8NC24.pdb.gz	RELL2_HUMAN RELT-like protein 2 OS=Homo sapiens OX=9606 GN=RELL2 PE=1 SV=1
2	AFDB:Q8BRJ3	0.444	0.444	7.295E-40	303	0.848	0.848	Q8BRJ3.pdb.gz	RELL2_MOUSE RELT-like protein 2 OS=Mus musculus OX=10090 GN=Rell2 PE=1 SV=1
3	AFDB:A0A0P0WFI1	0.122	0.072	4.573E-2	528	0.129	0.074	A0A0P0WFI1.pdb.gz	A0A0P0WFI1_ORYSJ Os04g0636700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0636700 PE=1 SV=1
4	AFDB:A0A2R8Y780	0.095	0.037	9.050E-2	889	0.182	0.062	A0A2R8Y780.pdb.gz	A0A2R8Y780_HUMAN Sodium/hydrogen exchanger OS=Homo sapiens OX=9606 GN=SLC9A3 PE=1 SV=1
5	AFDB:O35927	0.108	0.033	1.111E-1	1247	0.172	0.042	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
6	AFDB:O95503	0.115	0.091	1.562E-1	412	0.152	0.112	O95503.pdb.gz	CBX6_HUMAN Chromobox protein homolog 6 OS=Homo sapiens OX=9606 GN=CBX6 PE=1 SV=1
7	AFDB:Q8WZ55	0.109	0.096	2.053E-1	320	0.165	0.156	Q8WZ55.pdb.gz	BSND_HUMAN Barttin OS=Homo sapiens OX=9606 GN=BSND PE=1 SV=1
8	AFDB:A0A2R8Q9B9	0.079	0.079	2.198E-1	305	0.129	0.128	A0A2R8Q9B9.pdb.gz
9	AFDB:D3ZU00	0.099	0.049	2.353E-1	654	0.122	0.057	D3ZU00.pdb.gz	D3ZU00_RAT Prospero homeobox 1 OS=Rattus norvegicus OX=10116 GN=Prox1 PE=1 SV=3
10	AFDB:Q6ZN18	0.107	0.068	2.520E-1	517	0.158	0.093	Q6ZN18.pdb.gz	AEBP2_HUMAN Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2
11	PDB:6hivCR	0.087	0.085	2.150	314	0.083	0.080	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	PDB:7ungi	0.058	0.068	5.222	250	0.059	0.072	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:5wlcNB	0.074	0.148	7.346	142	0.050	0.106	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
14	PDB:7rroi	0.070	0.082	7.346	235	0.079	0.102	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:6elzJ	0.094	0.167	7.865	145	0.033	0.069	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
16	PDB:7mqaNB	0.068	0.134	7.865	103	0.050	0.146	7mqaNB.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:4behB	0.051	0.106	9.015	116	0.033	0.086	4behB.pdb.gz
18	PDB:7ung7	0.067	0.129	9.015	146	0.063	0.130	7ung7.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:2m0qA	0.100	0.214	9.652	123	0.056	0.138	2m0qA.pdb.gz
20	PDB:4v60A	0.134	0.058	9.652	812	0.063	0.023	4v60A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NC24	0.0	613	303	1.000	1.000	RELL2_HUMAN RELT-like protein 2 OS=Homo sapiens OX=9606 GN=RELL2 PE=1 SV=1
2	Q8BRJ3	1.18e-159	449	303	0.848	0.848	RELL2_MOUSE RELT-like protein 2 OS=Mus musculus OX=10090 GN=Rell2 PE=1 SV=1
3	Q8IUW5	7.40e-25	102	271	0.248	0.277	RELL1_HUMAN RELT-like protein 1 OS=Homo sapiens OX=9606 GN=RELL1 PE=1 SV=1
4	Q969Z4	1.91e-17	84.3	430	0.231	0.163	TR19L_HUMAN Tumor necrosis factor receptor superfamily member 19L OS=Homo sapiens OX=9606 GN=RELT PE=1 SV=1
5	Q8BX43	1.03e-14	76.3	436	0.215	0.149	TR19L_MOUSE Tumor necrosis factor receptor superfamily member 19L OS=Mus musculus OX=10090 GN=Relt PE=1 SV=2
6	Q86VR7	1.3	33.1	867	0.073	0.025	VS10L_HUMAN V-set and immunoglobulin domain-containing protein 10-like OS=Homo sapiens OX=9606 GN=VSIG10L PE=2 SV=2
7	Q9Z2Q1	6.1	31.2	1249	0.092	0.022	SC31A_RAT Protein transport protein Sec31A OS=Rattus norvegicus OX=10116 GN=Sec31a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12606 RELT	1.1e-19	80.6	Tumour necrosis factor receptor superfamily member 19

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297164

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311713	0.950	Serine/threonine-protein kinase OSR1
2	9606.ENSP00000348278	0.742	STE20/SPS1-related proline-alanine-rich protein kinase
3	9606.ENSP00000064780	0.655	Tumor necrosis factor receptor superfamily member 19L
4	9606.ENSP00000341684	0.644	Coiled-coil domain containing 15
5	9606.ENSP00000377357	0.620	Palmitoyltransferase ZDHHC16
6	9606.ENSP00000290536	0.573	Meiosis 1 arrest protein
7	9606.ENSP00000025301	0.514	A-kinase anchor protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0048522	0.977	positive regulation of cellular process
GO:0048583	0.967	regulation of response to stimulus
GO:0048584	0.956	positive regulation of response to stimulus
GO:0009966	0.942	regulation of signal transduction
GO:0009967	0.911	positive regulation of signal transduction
GO:0080134	0.821	regulation of response to stress
GO:1902531	0.805	regulation of intracellular signal transduction
GO:0070302	0.794	regulation of stress-activated protein kinase signaling cascade
GO:1900744	0.771	regulation of p38MAPK cascade
GO:1902533	0.734	positive regulation of intracellular signal transduction
GO:0009987	0.714	cellular process
GO:0070304	0.581	positive regulation of stress-activated protein kinase signaling cascade
GO:0032874	0.431	positive regulation of stress-activated MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0062023	0.989	collagen-containing extracellular matrix
GO:0005604	0.963	basement membrane
GO:0070013	0.937	intracellular organelle lumen
GO:0043227	0.926	membrane-bounded organelle
GO:0043231	0.908	intracellular membrane-bounded organelle
GO:0031981	0.904	nuclear lumen
GO:0005654	0.743	nucleoplasm
GO:0016020	0.697	membrane
GO:0005829	0.509	cytosol
GO:0005886	0.435	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]