StarFunc result for job id Q8NCC3

User Input

>input (412 residues)
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTV
VHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGK
TFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGD
GTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCC3	1.000	1.000	1.219E-91	412	1.000	1.000	Q8NCC3.pdb.gz	PAG15_HUMAN Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=2
2	AFDB:Q675A5	0.921	0.918	2.053E-83	413	0.883	0.881	Q675A5.pdb.gz	PAG15_RAT Phospholipase A2 group XV OS=Rattus norvegicus OX=10116 GN=Pla2g15 PE=1 SV=1
3	AFDB:Q8WMP9	0.946	0.957	2.102E-79	407	0.813	0.823	Q8WMP9.pdb.gz	PAG15_BOVIN Phospholipase A2 group XV OS=Bos taurus OX=9913 GN=PLA2G15 PE=1 SV=1
4	PDB:4x95B	0.909	0.993	5.352E-79	377	0.915	1.000	4x95B.pdb.gz	Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
5	AFDB:P18424	0.893	0.837	6.552E-57	440	0.466	0.436	P18424.pdb.gz	LCAT_RAT Phosphatidylcholine-sterol acyltransferase OS=Rattus norvegicus OX=10116 GN=Lcat PE=1 SV=2
6	AFDB:P04180	0.893	0.837	2.140E-56	440	0.473	0.443	P04180.pdb.gz	LCAT_HUMAN Phosphatidylcholine-sterol acyltransferase OS=Homo sapiens OX=9606 GN=LCAT PE=1 SV=1
7	PDB:5txfA	0.851	0.925	8.054E-50	378	0.449	0.489	5txfA.pdb.gz
8	AFDB:Q9I7L9	0.898	0.879	1.879E-48	421	0.359	0.352	Q9I7L9.pdb.gz	Q9I7L9_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18858 PE=4 SV=2
9	AFDB:Q9FZI8	0.851	0.813	9.628E-42	432	0.333	0.317	Q9FZI8.pdb.gz	LCAT1_ARATH Lecithin-cholesterol acyltransferase-like 1 OS=Arabidopsis thaliana OX=3702 GN=LCAT1 PE=2 SV=1
10	AFDB:B4DPU0	0.418	0.809	9.686E-31	212	0.417	0.811	B4DPU0.pdb.gz	B4DPU0_HUMAN Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=1
11	AFDB:C6KTC8	0.820	0.405	3.779E-30	863	0.265	0.126	C6KTC8.pdb.gz	C6KTC8_PLAF7 Phospholipase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0629300 PE=4 SV=1
12	AFDB:Q71N54	0.727	0.568	4.408E-24	535	0.211	0.163	Q71N54.pdb.gz	LCAT4_ARATH Lecithin-cholesterol acyltransferase-like 4 OS=Arabidopsis thaliana OX=3702 GN=LCAT4 PE=1 SV=1
13	PDB:4r1dA	0.467	0.383	2.367E-7	517	0.192	0.153	4r1dA.pdb.gz	The structural basis of the Tle4-Tli4 complex reveals the self-protection mechanism of H2-T6SS in Pseudomonas aeruginosa.
14	PDB:1tahB	0.307	0.381	1.414E-4	318	0.109	0.142	1tahB.pdb.gz	The crystal structure of triacylglycerol lipase from Pseudomonas glumae reveals a partially redundant catalytic aspartate.
15	PDB:1i6wB	0.296	0.636	2.017E-4	180	0.092	0.211	1i6wB.pdb.gz
16	PDB:3vvlB	0.289	0.316	4.901E-4	369	0.129	0.144	3vvlB.pdb.gz
17	PDB:7tvwA	0.273	0.393	6.590E-4	265	0.078	0.121	7tvwA.pdb.gz
18	PDB:7prmA	0.278	0.373	6.991E-4	295	0.075	0.105	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
19	PDB:1ex9A	0.328	0.450	8.350E-4	285	0.114	0.165	1ex9A.pdb.gz	Crystal structure of pseudomonas aeruginosa lipase in the open conformation. The prototype for family I.1 of bacterial lipases.
20	PDB:1exwA	0.304	0.415	8.859E-4	279	0.085	0.125	1exwA.pdb.gz	Structural basis for the insensitivity of a serine enzyme (palmitoyl-protein thioesterase) to phenylmethylsulfonyl fluoride.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q675A5	0.0	709	413	0.840	0.838	PAG15_RAT Phospholipase A2 group XV OS=Rattus norvegicus OX=10116 GN=Pla2g15 PE=1 SV=1
2	Q6XPZ3	0.0	716	408	0.854	0.863	PAG15_CANLF Phospholipase A2 group XV OS=Canis lupus familiaris OX=9615 GN=PLA2G15 PE=1 SV=1
3	Q8NCC3	0.0	850	412	1.000	1.000	PAG15_HUMAN Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=2
4	Q8VEB4	0.0	718	412	0.883	0.883	PAG15_MOUSE Phospholipase A2 group XV OS=Mus musculus OX=10090 GN=Pla2g15 PE=1 SV=1
5	Q8WMP9	0.0	662	407	0.779	0.789	PAG15_BOVIN Phospholipase A2 group XV OS=Bos taurus OX=9913 GN=PLA2G15 PE=1 SV=1
6	P04180	6.28e-134	393	440	0.451	0.423	LCAT_HUMAN Phosphatidylcholine-sterol acyltransferase OS=Homo sapiens OX=9606 GN=LCAT PE=1 SV=1
7	P18424	7.16e-134	393	440	0.439	0.411	LCAT_RAT Phosphatidylcholine-sterol acyltransferase OS=Rattus norvegicus OX=10116 GN=Lcat PE=1 SV=2
8	P16301	4.45e-133	391	438	0.442	0.416	LCAT_MOUSE Phosphatidylcholine-sterol acyltransferase OS=Mus musculus OX=10090 GN=Lcat PE=1 SV=2
9	B4DPU0	3.83e-123	357	212	0.413	0.802	B4DPU0_HUMAN Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=1
10	Q9Y168	2.46e-99	304	421	0.357	0.349	Q9Y168_DROME BcDNA.GH02384 OS=Drosophila melanogaster OX=7227 GN=BcDNA.GH02384 PE=2 SV=1
11	Q9I7L9	5.72e-99	303	421	0.354	0.347	Q9I7L9_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18858 PE=4 SV=2
12	Q9FZI8	7.42e-71	231	432	0.340	0.324	LCAT1_ARATH Lecithin-cholesterol acyltransferase-like 1 OS=Arabidopsis thaliana OX=3702 GN=LCAT1 PE=2 SV=1
13	C6KTC8	2.78e-28	119	863	0.282	0.134	C6KTC8_PLAF7 Phospholipase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0629300 PE=4 SV=1
14	O94680	9.09e-15	78.6	632	0.252	0.165	PDAT_SCHPO Phospholipid:diacylglycerol acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plh1 PE=1 SV=2
15	Q71N54	1.57e-12	71.2	535	0.180	0.138	LCAT4_ARATH Lecithin-cholesterol acyltransferase-like 4 OS=Arabidopsis thaliana OX=3702 GN=LCAT4 PE=1 SV=1
16	Q4VCM1	3.38e-12	70.5	633	0.155	0.101	LCAT2_ARATH Phospholipid--sterol O-acyltransferase OS=Arabidopsis thaliana OX=3702 GN=PSAT PE=2 SV=2
17	P40345	2.49e-08	58.5	661	0.146	0.091	PDAT_YEAST Phospholipid:diacylglycerol acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LRO1 PE=1 SV=1
18	Q9FNA9	7.18e-05	47.4	671	0.119	0.073	PDAT1_ARATH Phospholipid:diacylglycerol acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PDAT1 PE=2 SV=1
19	E9Q0G7	0.58	35.0	864	0.049	0.023	E9Q0G7_MOUSE Vomeronasal 2, receptor 83 OS=Mus musculus OX=10090 GN=Vmn2r83 PE=4 SV=1
20	A0A3B2WD89	0.69	34.7	442	0.049	0.045	A0A3B2WD89_MOUSE Vomeronasal 2, receptor 83 OS=Mus musculus OX=10090 GN=Vmn2r83 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	22	16.2	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	0.063	25.4	Alpha/beta hydrolase family
3	PF06028 DUF915	8.6e+02	10.6	Alpha/beta hydrolase of unknown function (DUF915)
4	PF12146 Hydrolase_4	67	14.2	Serine aminopeptidase, S33
5	PF02450 LCAT	3.1e-82	288.5	Lecithin:cholesterol acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407509	0.925	Neuropathy target esterase
2	9606.ENSP00000215885	0.910	Group 3 secretory phospholipase A2
3	9606.ENSP00000264005	0.903	Phosphatidylcholine-sterol acyltransferase
4	9606.ENSP00000368305	0.903	Glycerophosphocholine phosphodiesterase GPCPD1
5	9606.ENSP00000393847	0.899	Group 10 secretory phospholipase A2
6	9606.ENSP00000320043	0.898	Acyl-protein thioesterase 1
7	9606.ENSP00000333142	0.896	85/88 kDa calcium-independent phospholipase A2
8	9606.ENSP00000384610	0.880	Patatin-like phospholipase domain-containing protein 7
9	9606.ENSP00000362123	0.867	Group XIIB secretory phospholipase A2-like protein
10	9606.ENSP00000320337	0.854	HRAS-like suppressor 3
11	9606.ENSP00000364246	0.845	Group IID secretory phospholipase A2
12	9606.ENSP00000383364	0.845	Phospholipase A2, membrane associated
13	9606.ENSP00000330442	0.843	Phospholipase B1, membrane-associated
14	9606.ENSP00000228027	0.842	Diacylglycerol O-acyltransferase 2
15	9606.ENSP00000198801	0.828	2-acylglycerol O-acyltransferase 2
16	9606.ENSP00000406674	0.828	2-acylglycerol O-acyltransferase 1
17	9606.ENSP00000482264	0.822	Diacylglycerol O-acyltransferase 1
18	9606.ENSP00000312286	0.799	Phospholipase A2
19	9606.ENSP00000371886	0.799	JMJD7-PLA2G4B readthrough
20	9606.ENSP00000356436	0.797	Cytosolic phospholipase A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008374	1.000	O-acyltransferase activity
GO:0047499	1.000	calcium-independent phospholipase A2 activity
GO:0008970	0.998	phospholipase A1 activity
GO:0005488	0.997	binding
GO:0043167	0.893	ion binding
GO:0043169	0.876	cation binding
GO:0046872	0.847	metal ion binding
GO:0005515	0.657	protein binding
GO:0004622	0.615	lysophospholipase activity
GO:0046914	0.602	transition metal ion binding
GO:0008270	0.587	zinc ion binding
GO:0008289	0.562	lipid binding
GO:0005543	0.528	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044255	0.990	cellular lipid metabolic process
GO:0006796	0.982	phosphate-containing compound metabolic process
GO:0046486	0.981	glycerolipid metabolic process
GO:0019637	0.977	organophosphate metabolic process
GO:1901564	0.975	organonitrogen compound metabolic process
GO:0046470	0.965	phosphatidylcholine metabolic process
GO:0016042	0.910	lipid catabolic process
GO:0044242	0.900	cellular lipid catabolic process
GO:0044281	0.896	small molecule metabolic process
GO:0006665	0.818	sphingolipid metabolic process
GO:0043603	0.743	amide metabolic process
GO:0006672	0.636	ceramide metabolic process
GO:1901576	0.363	organic substance biosynthetic process
GO:0044249	0.354	cellular biosynthetic process
GO:0008610	0.327	lipid biosynthetic process
GO:0065007	0.308	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005576	0.992	extracellular region
GO:0070013	0.958	intracellular organelle lumen
GO:0005773	0.901	vacuole
GO:0016020	0.884	membrane
GO:0012505	0.870	endomembrane system
GO:0031982	0.862	vesicle
GO:0031090	0.860	organelle membrane
GO:0005764	0.857	lysosome
GO:0070062	0.810	extracellular exosome
GO:0031981	0.795	nuclear lumen
GO:0005654	0.787	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:15801	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	1.000	phospholipase A2.
RHEA:18689	0.998	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.32	0.998	phospholipase A1.
RHEA:15177	0.615	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	0.615	lysophospholipase.

[back to server]