StarFunc result for job id Q8NCG7

User Input

>input (672 residues)
MPGMVLFGRRWAIASDDLVFPGFFELVVRVLWWIGILTLYLMHRGKLDCAGGALLSSYLI
VLMILLAVVICTVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAWVA
DGVQCDRTVVNGIIATVVVSWIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQ
LLNGLKTAATSVWETRIKLLCCCIGKDDHTRVAFSSTAELFSTYFSDTDLVPSDIAAGLA
LLHQQQDNIRNNQEPAQVVCHAPGSSQEADLDAELENCHHYMQFAAAAYGWPLYIYRNPL
TGLCRIGGDCCRSRTTDYDLVGGDQLNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLV
ALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLI
NDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRGLWSKALQ
EYSQSFIVSLVLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNP
NNLPTELDGGDQEVLTQPLLGEQSLLTRWSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQ
EEGASGRFGCCSAAHYSAKWSHEAEFSKILIGPKMLTDHMPDILMRALDSVVSDRAACVS
CPAQGVSSVDVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCG7	1.000	1.000	0.000	672	1.000	1.000	Q8NCG7.pdb.gz	DGLB_HUMAN Diacylglycerol lipase-beta OS=Homo sapiens OX=9606 GN=DAGLB PE=1 SV=2
2	AFDB:Q91WC9	0.949	0.953	2.190E-92	669	0.789	0.792	Q91WC9.pdb.gz	DGLB_MOUSE Diacylglycerol lipase-beta OS=Mus musculus OX=10090 GN=Daglb PE=1 SV=2
3	AFDB:A0A2R8Q244	0.782	0.501	2.224E-47	1076	0.353	0.220	A0A2R8Q244.pdb.gz
4	AFDB:E7F0B3	0.732	0.485	3.274E-47	1051	0.354	0.226	E7F0B3.pdb.gz	E7F0B3_DANRE sn-1-specific diacylglycerol lipase OS=Danio rerio OX=7955 GN=dagla PE=4 SV=3
5	AFDB:Q6WQJ1	0.803	0.530	1.958E-46	1044	0.336	0.216	Q6WQJ1.pdb.gz	DGLA_MOUSE Diacylglycerol lipase-alpha OS=Mus musculus OX=10090 GN=Dagla PE=1 SV=2
6	AFDB:H0Z867	0.755	0.507	3.851E-46	1031	0.330	0.215	H0Z867.pdb.gz	H0Z867_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
7	AFDB:B7Z151	0.771	0.645	4.186E-44	815	0.315	0.260	B7Z151.pdb.gz	B7Z151_DROME Inactivation no afterpotential E, isoform F OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
8	AFDB:B7Z150	0.778	0.417	1.544E-43	1318	0.314	0.160	B7Z150.pdb.gz	B7Z150_DROME Inactivation no afterpotential E, isoform E OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
9	AFDB:H0Z871	0.681	0.471	1.769E-38	1008	0.314	0.209	H0Z871.pdb.gz	H0Z871_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
10	AFDB:Q940L4	0.268	0.277	1.015E-9	649	0.141	0.146	Q940L4.pdb.gz	PLIP3_ARATH Phospholipase A1 PLIP3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PLIP3 PE=1 SV=1
11	PDB:1uwcA	0.214	0.528	6.192E-8	261	0.060	0.153	1uwcA.pdb.gz	Structure of a Feruloyl Esterase from Aspergillus Niger
12	PDB:7xeyA	0.225	0.244	4.357E-6	614	0.076	0.083	7xeyA.pdb.gz	Identification and receptor mechanism of TIR-catalyzed small molecules in plant immunity.
13	PDB:7xjpA	0.223	0.255	9.909E-6	580	0.074	0.086	7xjpA.pdb.gz	TIR-catalyzed ADP-ribosylation reactions produce signaling molecules for plant immunity.
14	PDB:7x0cA	0.219	0.342	3.543E-4	402	0.076	0.127	7x0cA.pdb.gz
15	PDB:7xeyB	0.167	0.212	3.543E-4	519	0.049	0.064	7xeyB.pdb.gz	Identification and receptor mechanism of TIR-catalyzed small molecules in plant immunity.
16	PDB:3aikA	0.093	0.204	1.396E-2	283	0.028	0.067	3aikA.pdb.gz
17	PDB:4cg3A	0.098	0.214	2.263E-2	263	0.036	0.091	4cg3A.pdb.gz
18	PDB:5l2pA	0.119	0.232	1.171E-1	306	0.051	0.111	5l2pA.pdb.gz
19	PDB:4kryE	0.098	0.170	1.353E-1	329	0.037	0.076	4kryE.pdb.gz
20	PDB:6guiA	0.130	0.249	1.353E-1	283	0.045	0.106	6guiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ET49	0.0	1297	631	0.939	1.000	E7ET49_HUMAN sn-1-specific diacylglycerol lipase OS=Homo sapiens OX=9606 GN=DAGLB PE=1 SV=1
2	Q8NCG7	0.0	1381	672	1.000	1.000	DGLB_HUMAN Diacylglycerol lipase-beta OS=Homo sapiens OX=9606 GN=DAGLB PE=1 SV=2
3	Q91WC9	0.0	1078	669	0.789	0.792	DGLB_MOUSE Diacylglycerol lipase-beta OS=Mus musculus OX=10090 GN=Daglb PE=1 SV=2
4	E7F0B3	9.13e-124	395	1051	0.372	0.238	E7F0B3_DANRE sn-1-specific diacylglycerol lipase OS=Danio rerio OX=7955 GN=dagla PE=4 SV=3
5	Q6WQJ1	1.05e-116	376	1044	0.363	0.234	DGLA_MOUSE Diacylglycerol lipase-alpha OS=Mus musculus OX=10090 GN=Dagla PE=1 SV=2
6	H0Z867	2.97e-115	372	1031	0.356	0.232	H0Z867_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
7	Q9Y4D2	5.17e-115	371	1042	0.357	0.230	DGLA_HUMAN Diacylglycerol lipase-alpha OS=Homo sapiens OX=9606 GN=DAGLA PE=1 SV=3
8	X2JDP4	1.09e-107	344	729	0.330	0.305	X2JDP4_DROME Inactivation no afterpotential E, isoform H OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
9	Q86B55	2.23e-107	343	737	0.333	0.304	Q86B55_DROME Diacylglycerol lipase isoform D OS=Drosophila melanogaster OX=7227 GN=inaE PE=2 SV=1
10	B7Z151	1.15e-106	343	815	0.333	0.275	B7Z151_DROME Inactivation no afterpotential E, isoform F OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
11	X2JBS2	7.42e-102	340	1310	0.324	0.166	X2JBS2_DROME Inactivation no afterpotential E, isoform G OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
12	B7Z150	1.68e-101	339	1318	0.327	0.167	B7Z150_DROME Inactivation no afterpotential E, isoform E OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
13	H0Z871	4.04e-101	333	1008	0.339	0.226	H0Z871_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
14	Q8MR12	3.99e-97	314	644	0.299	0.312	Q8MR12_DROME Diacylglycerol lipase isoform A OS=Drosophila melanogaster OX=7227 GN=inaE PE=2 SV=1
15	Q2U7Y9	1.41e-07	56.2	306	0.083	0.183	Q2U7Y9_ASPOR Mono-and diacylglycerol lipase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000644 PE=4 SV=1
16	A2R709	7.07e-07	53.9	297	0.068	0.155	A2R709_ASPNC Contig An16c0070, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An16g01880 PE=4 SV=1
17	O42807	8.61e-07	53.5	281	0.051	0.121	FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger OX=5061 GN=faeA PE=1 SV=1
18	A2QSY5	8.69e-07	53.5	281	0.051	0.121	FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=faeA PE=3 SV=1
19	Q57YU6	2.70e-04	46.2	368	0.062	0.114	Q57YU6_TRYB2 Lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.120 PE=4 SV=1
20	Q387R7	4.74e-04	45.8	564	0.049	0.059	Q387R7_TRYB2 Class 3 lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0300 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07859 Abhydrolase_3	98	14.3	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	18	17.4	Alpha/beta hydrolase family
3	PF00756 Esterase	5.9	18.0	Putative esterase
4	PF12146 Hydrolase_4	24	15.6	Serine aminopeptidase, S33
5	PF01764 Lipase_3	3.4e-15	67.6	Lipase (class 3)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297056

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407112	0.865	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
2	9606.ENSP00000420315	0.839	Monoacylglycerol lipase ABHD6
3	9606.ENSP00000257215	0.834	Sn1-specific diacylglycerol lipase alpha
4	9606.ENSP00000243167	0.815	Fatty-acid amide hydrolase 1
5	9606.ENSP00000265052	0.810	Monoglyceride lipase
6	9606.ENSP00000364035	0.785	Fatty-acid amide hydrolase 2
7	9606.ENSP00000365725	0.777	Monoacylglycerol lipase ABHD12
8	9606.ENSP00000358513	0.756	Cannabinoid receptor 1
9	9606.ENSP00000414558	0.665	Protein ABHD4
10	9606.ENSP00000375894	0.610	G-protein coupled receptor 55
11	9606.ENSP00000261386	0.583	Glycerophosphodiester phosphodiesterase 1
12	9606.ENSP00000286733	0.561	N-acylethanolamine-hydrolyzing acid amidase
13	9606.ENSP00000387050	0.561	Phospholipase D3
14	9606.ENSP00000363596	0.529	Cannabinoid receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0052689	1.000	carboxylic ester hydrolase activity
GO:0016298	1.000	lipase activity
GO:0005515	0.993	protein binding
GO:0004806	0.990	triglyceride lipase activity
GO:0047372	0.963	acylglycerol lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044255	0.987	cellular lipid metabolic process
GO:0120254	0.977	olefinic compound metabolic process
GO:0006690	0.977	icosanoid metabolic process
GO:0001676	0.977	long-chain fatty acid metabolic process
GO:0033559	0.976	unsaturated fatty acid metabolic process
GO:0019369	0.959	arachidonic acid metabolic process
GO:0065007	0.507	biological regulation
GO:0050789	0.452	regulation of biological process
GO:0050794	0.443	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.998	nucleus
GO:0005654	0.989	nucleoplasm
GO:0005737	0.984	cytoplasm
GO:0031090	0.952	organelle membrane
GO:0005773	0.712	vacuole
GO:0000323	0.700	lytic vacuole
GO:0005764	0.692	lysosome
GO:0098588	0.686	bounding membrane of organelle
GO:0005765	0.338	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.
RHEA:12044	0.990	a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+)
EC:3.1.1.3	0.990	triacylglycerol lipase.
RHEA:34019	0.963	a 1-acylglycerol + H2O = a fatty acid + glycerol + H(+)
EC:3.1.1.23	0.963	acylglycerol lipase.

[back to server]