StarFunc result for job id Q8NCH0

User Input

>input (376 residues)
MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMI
ERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQP
GMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRL
KMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAE
IVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE
RLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFS
LFAYPLPNVTKEACQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCH0	1.000	1.000	5.222E-61	376	1.000	1.000	Q8NCH0.pdb.gz	CHSTE_HUMAN Carbohydrate sulfotransferase 14 OS=Homo sapiens OX=9606 GN=CHST14 PE=1 SV=2
2	AFDB:Q7T3S3	0.623	0.663	2.605E-21	352	0.316	0.338	Q7T3S3.pdb.gz	CHSTB_DANRE Carbohydrate sulfotransferase 11 OS=Danio rerio OX=7955 GN=chst11 PE=2 SV=1
3	AFDB:Q9JME2	0.615	0.654	3.517E-21	352	0.316	0.338	Q9JME2.pdb.gz	CHSTB_MOUSE Carbohydrate sulfotransferase 11 OS=Mus musculus OX=10090 GN=Chst11 PE=2 SV=1
4	AFDB:Q9H2A9	0.643	0.574	4.082E-20	424	0.314	0.278	Q9H2A9.pdb.gz	CHST8_HUMAN Carbohydrate sulfotransferase 8 OS=Homo sapiens OX=9606 GN=CHST8 PE=1 SV=2
5	AFDB:Q8BQ86	0.628	0.569	1.290E-19	417	0.314	0.283	Q8BQ86.pdb.gz	CHST8_MOUSE Carbohydrate sulfotransferase 8 OS=Mus musculus OX=10090 GN=Chst8 PE=2 SV=1
6	AFDB:Q8NET6	0.637	0.699	4.506E-19	341	0.332	0.367	Q8NET6.pdb.gz	CHSTD_HUMAN Carbohydrate sulfotransferase 13 OS=Homo sapiens OX=9606 GN=CHST13 PE=1 SV=1
7	AFDB:Q7L1S5	0.639	0.547	7.432E-19	443	0.269	0.228	Q7L1S5.pdb.gz	CHST9_HUMAN Carbohydrate sulfotransferase 9 OS=Homo sapiens OX=9606 GN=CHST9 PE=2 SV=2
8	AFDB:Q76EC5	0.638	0.583	8.635E-19	413	0.271	0.247	Q76EC5.pdb.gz	CHST9_MOUSE Carbohydrate sulfotransferase 9 OS=Mus musculus OX=10090 GN=Chst9 PE=2 SV=1
9	AFDB:O43529	0.617	0.650	5.780E-18	356	0.239	0.253	O43529.pdb.gz	CHSTA_HUMAN Carbohydrate sulfotransferase 10 OS=Homo sapiens OX=9606 GN=CHST10 PE=1 SV=1
10	AFDB:Q9NRB3	0.624	0.570	1.002E-17	414	0.311	0.283	Q9NRB3.pdb.gz	CHSTC_HUMAN Carbohydrate sulfotransferase 12 OS=Homo sapiens OX=9606 GN=CHST12 PE=2 SV=2
11	PDB:1aqyA	0.242	0.302	1.939E-1	283	0.077	0.102	1aqyA.pdb.gz	Crystal structure of estrogen sulphotransferase.
12	PDB:4jvlA	0.254	0.309	2.490E-1	292	0.061	0.079	4jvlA.pdb.gz	Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
13	PDB:1cjmA	0.228	0.340	4.539E-1	223	0.093	0.157	1cjmA.pdb.gz
14	PDB:5t05B	0.285	0.180	4.539E-1	677	0.104	0.058	5t05B.pdb.gz	Structure Based Substrate Specificity Analysis of Heparan Sulfate 6-O-Sulfotransferases.
15	PDB:2h8kA	0.197	0.275	4.772E-1	245	0.085	0.131	2h8kA.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
16	PDB:2zytX	0.253	0.311	5.545E-1	291	0.059	0.076	2zytX.pdb.gz	Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
17	PDB:1q1qA	0.295	0.374	7.486E-1	278	0.090	0.122	1q1qA.pdb.gz	Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.
18	PDB:3u3kA	0.199	0.243	7.486E-1	289	0.077	0.100	3u3kA.pdb.gz	The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
19	PDB:2gwhB	0.253	0.315	9.613E-1	288	0.074	0.097	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
20	PDB:7eovA	0.200	0.256	1.063	274	0.069	0.095	7eovA.pdb.gz	The crystal structure of mouse SULT2A8 reveals the mechanism of 7 alpha-hydroxyl, bile acid sulfation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NCH0	0.0	761	376	1.000	1.000	CHSTE_HUMAN Carbohydrate sulfotransferase 14 OS=Homo sapiens OX=9606 GN=CHST14 PE=1 SV=2
2	Q9JME2	7.62e-57	191	352	0.314	0.335	CHSTB_MOUSE Carbohydrate sulfotransferase 11 OS=Mus musculus OX=10090 GN=Chst11 PE=2 SV=1
3	Q9NPF2	2.20e-55	187	352	0.282	0.301	CHSTB_HUMAN Carbohydrate sulfotransferase 11 OS=Homo sapiens OX=9606 GN=CHST11 PE=1 SV=1
4	Q7T3S3	5.70e-53	181	352	0.285	0.304	CHSTB_DANRE Carbohydrate sulfotransferase 11 OS=Danio rerio OX=7955 GN=chst11 PE=2 SV=1
5	Q9H2A9	3.62e-45	162	424	0.293	0.259	CHST8_HUMAN Carbohydrate sulfotransferase 8 OS=Homo sapiens OX=9606 GN=CHST8 PE=1 SV=2
6	Q8BQ86	6.65e-45	161	417	0.287	0.259	CHST8_MOUSE Carbohydrate sulfotransferase 8 OS=Mus musculus OX=10090 GN=Chst8 PE=2 SV=1
7	Q8NET6	1.84e-42	153	341	0.287	0.317	CHSTD_HUMAN Carbohydrate sulfotransferase 13 OS=Homo sapiens OX=9606 GN=CHST13 PE=1 SV=1
8	Q9NRB3	5.94e-41	150	414	0.290	0.263	CHSTC_HUMAN Carbohydrate sulfotransferase 12 OS=Homo sapiens OX=9606 GN=CHST12 PE=2 SV=2
9	Q76EC5	1.82e-40	149	413	0.266	0.242	CHST9_MOUSE Carbohydrate sulfotransferase 9 OS=Mus musculus OX=10090 GN=Chst9 PE=2 SV=1
10	Q7L1S5	5.17e-40	149	443	0.255	0.217	CHST9_HUMAN Carbohydrate sulfotransferase 9 OS=Homo sapiens OX=9606 GN=CHST9 PE=2 SV=2
11	O43529	1.09e-27	114	356	0.207	0.219	CHSTA_HUMAN Carbohydrate sulfotransferase 10 OS=Homo sapiens OX=9606 GN=CHST10 PE=1 SV=1
12	Q6PGK7	1.17e-27	113	356	0.223	0.236	CHSTA_MOUSE Carbohydrate sulfotransferase 10 OS=Mus musculus OX=10090 GN=Chst10 PE=2 SV=2
13	O54702	8.52e-27	111	356	0.191	0.202	CHSTA_RAT Carbohydrate sulfotransferase 10 OS=Rattus norvegicus OX=10116 GN=Chst10 PE=1 SV=1
14	O17645	0.004	41.2	324	0.104	0.120	HST2_CAEEL Heparan sulfate 2-O-sulfotransferase hst-2 OS=Caenorhabditis elegans OX=6239 GN=hst-2 PE=1 SV=2
15	Q8QZS1	6.2	31.2	385	0.082	0.081	HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Hibch PE=1 SV=1
16	P43633	9.9	30.8	760	0.043	0.021	ALK1_YEAST Serine/threonine-protein kinase Haspin homolog ALK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALK1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03567 Sulfotransfer_2	1.7e-46	171.0	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307297

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332151	0.989	Dermatan-sulfate epimerase
2	9606.ENSP00000402394	0.980	Carbohydrate sulfotransferase 15
3	9606.ENSP00000052754	0.945	Decorin
4	9606.ENSP00000327336	0.933	Biglycan
5	9606.ENSP00000265077	0.927	Versican core protein
6	9606.ENSP00000402343	0.921	Zinc finger protein 469
7	9606.ENSP00000252575	0.916	Neurocan core protein
8	9606.ENSP00000331210	0.911	Brevican core protein
9	9606.ENSP00000312506	0.902	Chondroitin sulfate proteoglycan 4
10	9606.ENSP00000373244	0.901	Chondroitin sulfate proteoglycan 5
11	9606.ENSP00000362207	0.815	Carbohydrate sulfotransferase 3
12	9606.ENSP00000276055	0.803	Carbohydrate sulfotransferase 7
13	9606.ENSP00000029410	0.801	Beta-1,4-galactosyltransferase 7
14	9606.ENSP00000363590	0.798	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
15	9606.ENSP00000368496	0.791	Beta-1,3-galactosyltransferase 6
16	9606.ENSP00000265471	0.760	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
17	9606.ENSP00000411816	0.755	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
18	9606.ENSP00000356433	0.727	Uronyl 2-sulfotransferase
19	9606.ENSP00000254190	0.676	Chondroitin sulfate synthase 1
20	9606.ENSP00000230053	0.655	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001537	1.000	N-acetylgalactosamine 4-O-sulfotransferase activity
GO:0005488	0.844	binding
GO:0005515	0.807	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:1903510	0.988	mucopolysaccharide metabolic process
GO:0006024	0.988	glycosaminoglycan biosynthetic process
GO:0044272	0.981	sulfur compound biosynthetic process
GO:0030166	0.978	proteoglycan biosynthetic process
GO:0005975	0.961	carbohydrate metabolic process
GO:0005996	0.922	monosaccharide metabolic process
GO:0044283	0.872	small molecule biosynthetic process
GO:0016051	0.858	carbohydrate biosynthetic process
GO:0046364	0.749	monosaccharide biosynthetic process
GO:0019752	0.738	carboxylic acid metabolic process
GO:0016053	0.731	organic acid biosynthetic process
GO:0032787	0.677	monocarboxylic acid metabolic process
GO:0046394	0.673	carboxylic acid biosynthetic process
GO:0072330	0.498	monocarboxylic acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005576	0.996	extracellular region
GO:0005615	0.992	extracellular space
GO:0031982	0.981	vesicle
GO:1903561	0.955	extracellular vesicle
GO:0070062	0.950	extracellular exosome
GO:0070013	0.375	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.2.-	1.000	Sulfotransferases.

[back to server]