StarFunc result for job id Q8NCM2

User Input

>input (988 residues)
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
DEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSF
SRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTLSIPVDHPVRKLFQKFKQQKELR
NQGSTQGDPERNQLQVESRSLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRD
AMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLL
SEDPKSSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPIQADAKHPFYP
IPEQALQTTLQEVKHELKEDIQLLSCRMTALEKQVAEILKILSEKSVPQASSPKSQMPLQ
VPPQIPCQDIFSVSRPESPESDKDEIHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IEI6	0.748	0.772	0.000	956	0.709	0.732	A0A0R4IEI6.pdb.gz
2	AFDB:B3DHL9	0.733	0.754	0.000	959	0.731	0.753	B3DHL9.pdb.gz
3	AFDB:O95259	0.752	0.751	0.000	989	0.728	0.727	O95259.pdb.gz	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
4	AFDB:Q63472	0.763	0.783	0.000	962	0.736	0.756	Q63472.pdb.gz	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
5	AFDB:Q8NCM2	1.000	1.000	0.000	988	1.000	1.000	Q8NCM2.pdb.gz	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
6	AFDB:O44164	0.684	0.707	2.037E-89	956	0.457	0.473	O44164.pdb.gz	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
7	AFDB:B3DJX4	0.606	0.508	1.747E-69	1186	0.353	0.294	B3DJX4.pdb.gz
8	AFDB:O54853	0.609	0.633	4.502E-69	950	0.331	0.344	O54853.pdb.gz	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
9	AFDB:Q9H252	0.605	0.602	2.451E-68	994	0.317	0.315	Q9H252.pdb.gz	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
10	AFDB:Q9NS40	0.588	0.491	6.317E-68	1196	0.337	0.278	Q9NS40.pdb.gz	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
11	PDB:7rhsA	0.392	0.809	2.950E-25	456	0.114	0.248	7rhsA.pdb.gz
12	PDB:7wswA	0.357	0.687	5.927E-25	472	0.110	0.231	7wswA.pdb.gz
13	PDB:7n15A	0.377	0.674	2.392E-24	520	0.109	0.208	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
14	PDB:7rhsD	0.365	0.753	1.226E-22	441	0.094	0.211	7rhsD.pdb.gz
15	PDB:7calA	0.393	0.828	1.901E-21	444	0.098	0.218	7calA.pdb.gz
16	PDB:7xufA	0.366	0.698	5.690E-21	476	0.112	0.233	7xufA.pdb.gz
17	PDB:7o4hB	0.382	0.758	2.297E-20	468	0.111	0.235	7o4hB.pdb.gz
18	PDB:7o4hD	0.252	0.600	7.360E-12	383	0.064	0.164	7o4hD.pdb.gz
19	PDB:2wkpA	0.108	0.329	2.482E-8	320	0.030	0.094	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
20	PDB:6eo1A	0.126	0.284	4.293E-8	355	0.067	0.186	6eo1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PPA2	0.0	670	605	0.359	0.587	A0A1W2PPA2_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
2	K4EHU2	0.0	1437	956	0.713	0.736	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
3	O18965	0.0	1486	987	0.741	0.742	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
4	O44164	0.0	882	956	0.432	0.447	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
5	O54853	0.0	562	950	0.293	0.304	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
6	O95259	0.0	1491	989	0.742	0.741	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
7	Q02280	0.0	1017	1174	0.492	0.414	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
8	Q108P3	0.0	1439	959	0.737	0.759	Q108P3_DANRE Potassium voltage-gated channel subfamily H member 1 OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
9	Q60603	0.0	1485	989	0.733	0.732	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
10	Q63472	0.0	1508	962	0.743	0.763	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
11	Q8NCM2	0.0	2061	988	1.000	1.000	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
12	Q9EPI9	0.0	2028	988	0.983	0.983	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
13	Q9H252	0.0	556	994	0.293	0.291	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
14	Q96L42	1.24e-163	511	1107	0.279	0.249	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
15	Q9QWS8	2.38e-162	508	1102	0.278	0.250	KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus OX=10116 GN=Kcnh8 PE=2 SV=2
16	Q9ULD8	6.57e-157	493	1083	0.277	0.253	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
17	A8WHX9	4.21e-156	486	914	0.283	0.306	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
18	Q9UQ05	7.18e-156	488	1017	0.288	0.280	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
19	O54852	1.89e-154	489	1195	0.242	0.200	KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus OX=10116 GN=Kcnh7 PE=1 SV=1
20	Q9NS40	4.41e-154	489	1196	0.242	0.200	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	3.7e-09	47.9	Cyclic nucleotide-binding domain
2	PF07883 Cupin_2	44	15.2	Cupin domain
3	PF05899 Cupin_3	2.1e+02	13.0	EutQ-like cupin domain
4	PF00520 Ion_trans	1.2e-31	121.4	Ion transport protein
5	PF07885 Ion_trans_2	4.6e-09	47.4	Ion channel
6	PF05531 NPV_P10	1.4e+02	14.4	Nucleopolyhedrovirus P10 protein
7	PF00989 PAS	0.0026	29.1	PAS fold
8	PF08447 PAS_3	0.7	21.5	PAS fold
9	PF08448 PAS_4	35	16.1	PAS fold
10	PF13426 PAS_9	5.3e-13	60.5	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321427

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419952	0.872	Voltage-gated potassium channel subunit beta-1
2	9606.ENSP00000367323	0.850	Voltage-gated potassium channel subunit beta-2
3	9606.ENSP00000302719	0.848	Voltage-gated potassium channel subunit beta-3
4	9606.ENSP00000433109	0.831	Potassium voltage-gated channel subfamily A member 2
5	9606.ENSP00000352035	0.816	Potassium voltage-gated channel subfamily KQT member 2
6	9606.ENSP00000333496	0.814	Potassium voltage-gated channel subfamily D member 2
7	9606.ENSP00000373648	0.814	Potassium voltage-gated channel subfamily KQT member 3
8	9606.ENSP00000430846	0.810	Potassium voltage-gated channel subfamily B member 2
9	9606.ENSP00000360806	0.801	Potassium voltage-gated channel subfamily B member 1
10	9606.ENSP00000218176	0.796	Potassium voltage-gated channel subfamily D member 1
11	9606.ENSP00000358786	0.796	Potassium voltage-gated channel subfamily A member 10
12	9606.ENSP00000371985	0.791	Potassium voltage-gated channel subfamily A member 1
13	9606.ENSP00000345055	0.789	Potassium voltage-gated channel subfamily KQT member 5
14	9606.ENSP00000434241	0.789	Potassium voltage-gated channel subfamily C member 3
15	9606.ENSP00000328511	0.783	Potassium voltage-gated channel subfamily A member 4
16	9606.ENSP00000265969	0.782	Potassium voltage-gated channel subfamily C member 1
17	9606.ENSP00000319591	0.782	Potassium voltage-gated channel subfamily D member 3
18	9606.ENSP00000155840	0.776	Potassium voltage-gated channel subfamily KQT member 1
19	9606.ENSP00000358784	0.767	Potassium voltage-gated channel subfamily A member 3
20	9606.ENSP00000371514	0.750	Potassium voltage-gated channel subfamily V member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005249	0.999	voltage-gated potassium channel activity
GO:0005515	0.995	protein binding
GO:0005251	0.928	delayed rectifier potassium channel activity
GO:0044325	0.861	transmembrane transporter binding
GO:0044877	0.742	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.943	biological regulation
GO:0050789	0.922	regulation of biological process
GO:0050794	0.773	regulation of cellular process
GO:0009987	0.716	cellular process
GO:0006811	0.680	monoatomic ion transport
GO:0030001	0.582	metal ion transport
GO:0006813	0.530	potassium ion transport
GO:1902749	0.510	regulation of cell cycle G2/M phase transition
GO:0055085	0.442	transmembrane transport
GO:0010389	0.382	regulation of G2/M transition of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.847	cell surface
GO:0032991	0.776	protein-containing complex
GO:0098797	0.666	plasma membrane protein complex
GO:0034702	0.638	ion channel complex
GO:0034703	0.627	cation channel complex
GO:0008076	0.565	voltage-gated potassium channel complex
GO:0005622	0.315	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.999	K(+)(in) = K(+)(out)

[back to server]