StarFunc result for job id Q8NCM8

User Input

>input (1400 residues)
MANGTADVRKLFIFTTTQNYFGLMSELWDQPLLCNCLEINNFLDDGNQMLLRVQRSDAGI
SFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPML
LKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWI
EQAHRGNKQISKERANYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWRQTEH
DHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDPYYLVKESLKAGISICEQWVIVCNH
LTGQVWQRYVPHPWKNEKYFPETLDKLGKRLEEVLAIRTIHEKFLYFLPASEEKIICLTR
VFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDSPQQLLQA
FLKYKELVKRPTISKELMLERETLLARLVDSIKDFRLDFENRCRGIPGDASGPLSGKNLS
EVVNSIVWVRQLELKVDDTIKIAEALLSDLPGFRCFHQSAKDLLDQLKLYEQEQFDDWSR
DIQSGLSDSRSGLCIEASSRIMELDSNDGLLKVHYSDRLVILLREVRQLSALGFVIPAKI
QQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGK
SQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKD
GLQELRTGLATVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLT
YKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEAGDESIFSIMIDRNASGFLTIF
SKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLP
SAVKVDCLNINCNPVKTVIDDLIQKLFDLLVLSLKKSIQAHLHEIDTFVTEAMEVLTIMP
QSVEEIGDANLQYSKLQERKPEILPLFQEAEDKNRLLRTVAGGGLETISNLKAKWDKFEL
MMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPGDDVIETGQHNTLDKSA
KLIKEKKIEFDDLEVTRKKLVDDCHHFRLEEPNFSLASSISKDIESCAQIWAFYEEFQQG
FQEMANEDWITFRTKTYLFEEFLMNWHDRLRKVEEHSVMTVKLQSEVDKYKIVIPILKYV
RGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKAADLKDLNSRAQGEVTI
REALRELDLWGVGAVFTLIDYEDSQSRTMKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNRVDEDFRSIMT
DIKKDNRVTTLTTHAGIRNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.270	0.102	3.922E-37	4579	0.191	0.058	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7kzmC	0.206	0.088	6.527E-15	3890	0.133	0.048	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
3	PDB:7z8jf	0.301	0.576	3.506E-13	674	0.091	0.188	7z8jf.pdb.gz
4	AFDB:A0A0R4IUQ6	0.169	0.336	1.764E-11	614	0.056	0.127	A0A0R4IUQ6.pdb.gz
5	AFDB:Q9VN30	0.142	0.177	4.132E-10	1079	0.077	0.100	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
6	AFDB:Q57ZY4	0.165	0.452	5.643E-9	470	0.045	0.134	Q57ZY4.pdb.gz	Q57ZY4_TRYB2 Dynein heavy chain, putative (Fragment) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb927.4.560 PE=4 SV=1
7	PDB:7z8gA	0.175	0.082	4.907E-5	3047	0.047	0.022	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
8	AFDB:Q8JGN7	0.125	0.734	8.215E-5	202	0.031	0.213	Q8JGN7.pdb.gz
9	AFDB:Q5SX07	0.142	0.370	8.564E-5	457	0.044	0.136	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
10	PDB:5yu7A	0.081	0.096	5.012E-4	1118	0.104	0.131	5yu7A.pdb.gz
11	PDB:7mopA	0.077	0.052	6.168E-4	2445	0.124	0.071	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
12	AFDB:Q8BXT7	0.097	0.563	1.630E-3	203	0.021	0.143	Q8BXT7.pdb.gz	Q8BXT7_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Dnah9 PE=2 SV=1
13	AFDB:P11277	0.062	0.047	2.368E-3	2137	0.145	0.095	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
14	PDB:6bcuA	0.075	0.056	2.426E-3	2204	0.113	0.072	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
15	AFDB:Q62768	0.091	0.079	2.573E-3	1735	0.085	0.069	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
16	AFDB:Q54P24	0.077	0.083	3.166E-3	1215	0.110	0.127	Q54P24.pdb.gz	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
17	PDB:3w3uA	0.075	0.092	3.243E-3	1030	0.099	0.134	3w3uA.pdb.gz
18	PDB:3wyfC	0.080	0.096	3.829E-3	1040	0.084	0.113	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
19	PDB:1xi4A	0.067	0.061	4.160E-3	1630	0.124	0.107	1xi4A.pdb.gz
20	AFDB:Q9UPW8	0.092	0.079	7.890E-3	1703	0.086	0.070	Q9UPW8.pdb.gz	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6XEZ2	0.0	701	4232	0.284	0.094	D6XEZ2_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.720 PE=4 SV=1
2	Q0E8P6	0.0	621	4236	0.286	0.095	Q0E8P6_DROME Beethoven OS=Drosophila melanogaster OX=7227 GN=btv PE=3 SV=3
3	Q19542	0.0	879	4171	0.359	0.120	DYHC2_CAEEL Cytoplasmic dynein 2 heavy chain 1 OS=Caenorhabditis elegans OX=6239 GN=che-3 PE=1 SV=2
4	Q45VK7	0.0	2694	4306	0.918	0.298	DYHC2_MOUSE Cytoplasmic dynein 2 heavy chain 1 OS=Mus musculus OX=10090 GN=Dync2h1 PE=1 SV=1
5	Q57UR9	0.0	604	3762	0.236	0.088	Q57UR9_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb927.4.560 PE=4 SV=1
6	Q8NCM8	0.0	2892	4307	1.000	0.325	DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC2H1 PE=1 SV=4
7	Q9JJ79	0.0	2697	4306	0.920	0.299	DYHC2_RAT Cytoplasmic dynein 2 heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2h1 PE=1 SV=1
8	Q9SMH5	0.0	734	4334	0.326	0.105	DYHC2_CHLRE Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1B PE=1 SV=2
9	Q386R7	6.31e-153	517	4307	0.243	0.079	Q386R7_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0030 PE=4 SV=1
10	D3YYQ8	7.49e-29	129	4591	0.191	0.058	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
11	Q57ZY4	5.87e-24	109	470	0.047	0.140	Q57ZY4_TRYB2 Dynein heavy chain, putative (Fragment) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb927.4.560 PE=4 SV=1
12	F7ABZ6	8.13e-24	112	4534	0.149	0.046	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
13	E7FGT8	1.22e-23	112	4626	0.175	0.053	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
14	P45444	5.89e-20	99.8	4345	0.061	0.020	DYHC_EMENI Dynein heavy chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudA PE=3 SV=2
15	Q2U6C3	6.83e-19	96.3	4346	0.060	0.019	Q2U6C3_ASPOR Dynein heavy chain, cytoplasmic OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000298 PE=4 SV=1
16	Q9MBF8	8.32e-19	95.9	4513	0.071	0.022	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
17	Q9P225	8.59e-19	95.9	4427	0.076	0.024	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
18	P37276	1.24e-16	89.0	4639	0.063	0.019	DYHC_DROME Dynein heavy chain, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Dhc64C PE=2 SV=2
19	P0C6F1	1.80e-16	88.6	4456	0.075	0.024	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
20	Q9SMH3	2.05e-16	88.2	4625	0.076	0.023	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08385 DHC_N1	1.8e-34	131.1	Dynein heavy chain, N-terminal region 1
2	PF08393 DHC_N2	7.2e-56	201.6	Dynein heavy chain, N-terminal region 2
3	PF03792 PBC	1.5e+02	13.5	PBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000474032	0.999	Cytoplasmic dynein 2 light intermediate chain 1
2	9606.ENSP00000361800	0.993	WD repeat-containing protein 34
3	9606.ENSP00000376297	0.992	Dynein light chain 1, cytoplasmic
4	9606.ENSP00000384290	0.990	WD repeat-containing protein 60
5	9606.ENSP00000349679	0.982	Dynein light chain roadblock-type 1
6	9606.ENSP00000312778	0.979	Intraflagellar transport protein 80 homolog
7	9606.ENSP00000260570	0.966	Intraflagellar transport protein 172 homolog
8	9606.ENSP00000406012	0.957	Intraflagellar transport protein 140 homolog
9	9606.ENSP00000382717	0.952	WD repeat-containing protein 19
10	9606.ENSP00000323580	0.950	Intraflagellar transport protein 88 homolog
11	9606.ENSP00000390436	0.948	Zinc finger protein GLI2
12	9606.ENSP00000379258	0.945	Transcriptional activator GLI3
13	9606.ENSP00000258198	0.941	Cytoplasmic dynein 1 light intermediate chain 2
14	9606.ENSP00000273130	0.941	Cytoplasmic dynein 1 light intermediate chain 1
15	9606.ENSP00000362121	0.941	Intraflagellar transport protein 52 homolog
16	9606.ENSP00000296266	0.940	Intraflagellar transport protein 122 homolog
17	9606.ENSP00000228682	0.937	Zinc finger protein GLI1
18	9606.ENSP00000358918	0.935	Suppressor of fused homolog
19	9606.ENSP00000243344	0.934	Tetratricopeptide repeat protein 21B
20	9606.ENSP00000380308	0.931	Cytoplasmic dynein 1 intermediate chain 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003774	0.986	cytoskeletal motor activity
GO:0003777	0.977	microtubule motor activity
GO:0008569	0.930	minus-end-directed microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.979	cellular component organization
GO:0006996	0.894	organelle organization
GO:0010256	0.514	endomembrane system organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005929	0.998	cilium
GO:0005856	0.998	cytoskeleton
GO:0032991	0.978	protein-containing complex
GO:0012505	0.969	endomembrane system
GO:0043231	0.910	intracellular membrane-bounded organelle
GO:0015630	0.895	microtubule cytoskeleton
GO:1902494	0.818	catalytic complex
GO:0005576	0.763	extracellular region
GO:0005875	0.655	microtubule associated complex
GO:0031982	0.654	vesicle
GO:0030286	0.629	dynein complex
GO:0099512	0.621	supramolecular fiber
GO:0099513	0.594	polymeric cytoskeletal fiber
GO:0005874	0.542	microtubule
GO:0005615	0.486	extracellular space
GO:0097542	0.458	ciliary tip
GO:0099568	0.457	cytoplasmic region
GO:1903561	0.440	extracellular vesicle
GO:0032838	0.387	plasma membrane bounded cell projection cytoplasm
GO:0005868	0.376	cytoplasmic dynein complex
GO:0070062	0.371	extracellular exosome
GO:0097014	0.319	ciliary plasm
GO:0005930	0.305	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]