StarFunc result for job id Q8NCN5

User Input

>input (879 residues)
MMFYRLLSIVGRQRASPGWQNWSSARNSTSAAEARSMALPTQAQVVICGGGITGTSVAYH
LSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYYQLEQETGIQT
GYTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHV
PEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNC
AGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGI
LSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPET
FTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVHGYPSENVWELDLKRF
GALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFE
RPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQ
ALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKRSFFMISPTDQQVHCWA
WLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGY
ANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFA
FWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDSDLD
LWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINRGEY
EIDIAGYRFQAKAKLYPVASLFTQKRRKDDMELSDLHGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCN5	1.000	1.000	0.000	879	1.000	1.000	Q8NCN5.pdb.gz	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
2	AFDB:Q9UL12	0.885	0.848	7.751E-87	918	0.323	0.309	Q9UL12.pdb.gz	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
3	AFDB:Q64380	0.883	0.846	1.507E-86	919	0.312	0.298	Q64380.pdb.gz	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
4	AFDB:Q8IGS5	0.886	0.859	5.938E-82	907	0.283	0.275	Q8IGS5.pdb.gz	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
5	AFDB:Q9UI17	0.874	0.886	2.598E-78	866	0.292	0.297	Q9UI17.pdb.gz	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
6	AFDB:Q9DBT9	0.875	0.885	4.332E-78	869	0.294	0.297	Q9DBT9.pdb.gz	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
7	PDB:4pabB	0.869	0.925	7.530E-77	824	0.282	0.301	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
8	AFDB:Q9HTE6	0.403	0.354	5.326E-32	1005	0.164	0.143	Q9HTE6.pdb.gz	Q9HTE6_PSEAE Sarcosine oxidase alpha subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxA PE=3 SV=1
9	AFDB:Q5JFG7	0.404	0.895	2.728E-30	386	0.098	0.223	Q5JFG7.pdb.gz	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
10	AFDB:P49364	0.396	0.834	3.015E-29	408	0.098	0.211	P49364.pdb.gz	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
11	AFDB:Q9HTE8	0.397	0.817	6.492E-29	416	0.098	0.207	Q9HTE8.pdb.gz	Q9HTE8_PSEAE Sarcosine oxidase beta subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxB PE=4 SV=1
12	PDB:1wsvA	0.389	0.897	1.247E-26	371	0.092	0.218	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
13	PDB:4yshA	0.376	0.846	2.685E-26	370	0.104	0.246	4yshA.pdb.gz	Crystal structure of glycine oxidase from Geobacillus kaustophilus
14	PDB:1vloA	0.369	0.865	1.527E-25	364	0.091	0.220	1vloA.pdb.gz
15	PDB:3if9A	0.361	0.823	7.046E-23	364	0.089	0.214	3if9A.pdb.gz	Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
16	PDB:3nycA	0.367	0.801	9.555E-22	381	0.075	0.173	3nycA.pdb.gz	Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
17	PDB:2uzzB	0.380	0.857	2.513E-19	372	0.063	0.148	2uzzB.pdb.gz	The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
18	PDB:5oc2A	0.369	0.696	8.533E-17	441	0.073	0.145	5oc2A.pdb.gz	Thermal stabilization of the deglycating enzyme Amadoriase I by rational design.
19	PDB:3awiD	0.342	0.444	8.090E-16	659	0.066	0.088	3awiD.pdb.gz	Crystal structure of the bifunctional tRNA modification enzyme MnmC from Escherichia coli
20	PDB:2qcuB	0.329	0.547	2.486E-14	501	0.063	0.110	2qcuB.pdb.gz	Structure of glycerol-3-phosphate dehydrogenase, an essential monotopic membrane enzyme involved in respiration and metabolism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TSQ8	0.0	1631	878	0.922	0.923	PDPR_MOUSE Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Mus musculus OX=10090 GN=Pdpr PE=1 SV=1
2	Q8NCN5	0.0	1844	879	1.000	1.000	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
3	Q9UL12	1.57e-139	439	918	0.322	0.308	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
4	Q64380	5.79e-136	430	919	0.311	0.297	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
5	Q99LB7	1.70e-135	429	919	0.309	0.296	SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Sardh PE=1 SV=1
6	Q9UI17	3.04e-111	363	866	0.294	0.298	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
7	A1ZAZ2	7.34e-110	360	894	0.299	0.294	A1ZAZ2_DROME Sarcosine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Sardh PE=1 SV=1
8	Q9DBT9	2.95e-109	358	869	0.290	0.293	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
9	Q8IGS5	3.32e-108	356	907	0.299	0.290	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
10	Q63342	4.27e-107	352	857	0.287	0.294	M2GD_RAT Dimethylglycine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dmgdh PE=1 SV=1
11	O96023	1.32e-72	248	475	0.168	0.312	O96023_HUMAN Dimethylglycine dehydrogenase-like protein isoform 2 OS=Homo sapiens OX=9606 PE=2 SV=1
12	Q8TCC6	1.53e-69	244	613	0.203	0.290	Q8TCC6_HUMAN DMGDH protein (Fragment) OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=1
13	Q961K2	1.06e-65	233	600	0.193	0.283	Q961K2_DROME GH19226p OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
14	Q9UL11	2.03e-45	168	328	0.122	0.326	Q9UL11_HUMAN Uncharacterized protein SARDH (Fragment) OS=Homo sapiens OX=9606 GN=SARDH PE=2 SV=1
15	Q9UL10	4.02e-39	152	396	0.104	0.230	Q9UL10_HUMAN Sarcosine dehydrogenase OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
16	Q5JFG7	9.44e-23	103	386	0.102	0.233	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
17	Q9HTE6	3.58e-16	85.9	1005	0.088	0.077	Q9HTE6_PSEAE Sarcosine oxidase alpha subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxA PE=3 SV=1
18	P49364	1.71e-14	79.0	408	0.111	0.240	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
19	O65396	2.74e-14	78.2	408	0.115	0.248	GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1
20	O14110	2.40e-12	72.0	387	0.098	0.222	GCST_SCHPO Probable aminomethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	1.4e-54	197.6	FAD dependent oxidoreductase
2	PF00890 FAD_binding_2	5.7e-05	34.0	FAD binding domain
3	PF01494 FAD_binding_3	0.55	21.0	FAD binding domain
4	PF12831 FAD_oxidored	36	15.1	FAD dependent oxidoreductase
5	PF16350 FAO_M	2.4e-12	58.2	FAD dependent oxidoreductase central domain
6	PF01571 GCV_T	1.2e-69	246.0	Aminomethyltransferase folate-binding domain
7	PF08669 GCV_T_C	8.8e-09	46.4	Glycine cleavage T-protein C-terminal barrel domain
8	PF00732 GMC_oxred_N	3.8	18.4	GMC oxidoreductase
9	PF03486 HI0933_like	13	16.0	HI0933-like protein
10	PF13450 NAD_binding_8	28	16.3	NAD(P)-binding Rossmann-like domain
11	PF00070 Pyr_redox	1e+02	14.9	Pyridine nucleotide-disulphide oxidoreductase
12	PF07992 Pyr_redox_2	0.00041	31.3	Pyridine nucleotide-disulphide oxidoreductase
13	PF13738 Pyr_redox_3	0.56	21.0	Pyridine nucleotide-disulphide oxidoreductase
14	PF01946 Thi4	0.34	21.7	Thi4 family
15	PF02254 TrkA_N	3.6e+02	12.8	TrkA-N domain
16	PF04820 Trp_halogenase	2.3	18.6	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227868	0.950	Pyruvate dehydrogenase protein X component, mitochondrial
2	9606.ENSP00000307241	0.945	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
3	9606.ENSP00000280346	0.938	Dihydrolipoamide S-acetyltransferase
4	9606.ENSP00000369134	0.936	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
5	9606.ENSP00000205402	0.926	Dihydrolipoyl dehydrogenase, mitochondrial
6	9606.ENSP00000295266	0.925	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
7	9606.ENSP00000309548	0.917	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
8	9606.ENSP00000379503	0.884	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
9	9606.ENSP00000319531	0.745	Glycine cleavage system H protein, mitochondrial
10	9606.ENSP00000360366	0.741	Acyl-coenzyme A thioesterase 11
11	9606.ENSP00000370737	0.722	Glycine dehydrogenase (decarboxylating), mitochondrial
12	9606.ENSP00000360645	0.659	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
13	9606.ENSP00000367299	0.639	Vacuolar protein-sorting-associated protein 36
14	9606.ENSP00000318868	0.623	Serine hydroxymethyltransferase, cytosolic
15	9606.ENSP00000333667	0.572	Serine hydroxymethyltransferase, mitochondrial
16	9606.ENSP00000351484	0.566	N-acetylated-alpha-linked acidic dipeptidase-like protein
17	9606.ENSP00000371253	0.526	Trifunctional purine biosynthetic protein adenosine-3
18	9606.ENSP00000254051	0.525	Tensin-4
19	9606.ENSP00000379217	0.508	Ubiquitin domain-containing protein UBFD1
20	9606.ENSP00000362123	0.503	Group XIIB secretory phospholipase A2-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	0.997	heterocyclic compound binding
GO:0097159	0.997	organic cyclic compound binding
GO:0016645	0.997	oxidoreductase activity, acting on the CH-NH group of donors
GO:0043167	0.883	ion binding
GO:0043168	0.853	anion binding
GO:0046997	0.838	oxidoreductase activity, acting on the CH-NH group of donors, flavin as acceptor
GO:0036094	0.829	small molecule binding
GO:0050660	0.818	flavin adenine dinucleotide binding
GO:0005515	0.520	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.998	metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.986	cellular metabolic process
GO:1901564	0.975	organonitrogen compound metabolic process
GO:0009056	0.760	catabolic process
GO:0044281	0.697	small molecule metabolic process
GO:0044238	0.649	primary metabolic process
GO:1901565	0.599	organonitrogen compound catabolic process
GO:0019752	0.410	carboxylic acid metabolic process
GO:1901360	0.374	organic cyclic compound metabolic process
GO:0006575	0.353	cellular modified amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.899	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.-.-	0.997	Acting on the CH-NH group of donors.
EC:1.5.8.-	0.838	With a flavin as acceptor.

[back to server]