StarFunc result for job id Q8NCR0

User Input

>input (500 residues)
MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTHYDVVVGVLSA
RNNHELRNVIRSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNITNP
VLNQEIEAFSLSEDTSSGLPEDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLY
QAEQEEALFIARFSPPSCGVQVNKLWYKPVEQFILPESFEGTIVWESQDLHGLVSRNLHK
VTVNDGGGVLRVITAGEGALPHEFLEGVEGVAGGFIYTIQEGDALLHNLHSRPQRLIDHI
RNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFNLLLKTDDDCY
IDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISK
DIVKWLASNSGRLKTYQGEDVSMGIWMAAIGPKRYQDSLWLCEKTCETGMLSSPQYSPWE
LTELWKLKERCGDPCRCQAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCR0	1.000	1.000	0.000	500	1.000	1.000	Q8NCR0.pdb.gz	B3GL2_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALNT2 PE=1 SV=1
2	AFDB:Q502B3	0.868	0.883	7.608E-68	491	0.518	0.527	Q502B3.pdb.gz	B3GL2_DANRE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Danio rerio OX=7955 GN=b3galnt2 PE=2 SV=1
3	AFDB:Q9N491	0.475	0.706	7.880E-20	330	0.148	0.224	Q9N491.pdb.gz	SQV2_CAEEL Beta-1,3-galactosyltransferase sqv-2 OS=Caenorhabditis elegans OX=6239 GN=sqv-2 PE=2 SV=1
4	AFDB:Q96L58	0.465	0.698	5.933E-19	329	0.170	0.258	Q96L58.pdb.gz	B3GT6_HUMAN Beta-1,3-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B3GALT6 PE=1 SV=2
5	AFDB:Q91Z92	0.474	0.715	9.541E-19	325	0.152	0.234	Q91Z92.pdb.gz	B3GT6_MOUSE Beta-1,3-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B3galt6 PE=2 SV=1
6	AFDB:Q9ASW1	0.368	0.300	1.170E-16	619	0.176	0.142	Q9ASW1.pdb.gz	B3GTG_ARATH Hydroxyproline O-galactosyltransferase GALT3 OS=Arabidopsis thaliana OX=3702 GN=GALT3 PE=2 SV=1
7	AFDB:A1Z7G9	0.422	0.546	1.997E-16	382	0.164	0.215	A1Z7G9.pdb.gz	A1Z7G9_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=beta3GalTII PE=2 SV=1
8	AFDB:F4JIK9	0.365	0.249	6.549E-16	741	0.162	0.109	F4JIK9.pdb.gz	F4JIK9_ARATH Galactosyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
9	AFDB:Q8L7F9	0.369	0.289	6.949E-16	643	0.176	0.137	Q8L7F9.pdb.gz	B3GTF_ARATH Beta-1,3-galactosyltransferase GALT1 OS=Arabidopsis thaliana OX=3702 GN=GALT1 PE=1 SV=1
10	AFDB:Q8RX55	0.366	0.275	1.053E-15	672	0.166	0.124	Q8RX55.pdb.gz	B3GTI_ARATH Hydroxyproline O-galactosyltransferase GALT5 OS=Arabidopsis thaliana OX=3702 GN=GALT5 PE=1 SV=1
11	PDB:7jhiC	0.345	0.511	1.989E-11	331	0.082	0.124	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:4fixA	0.203	0.166	1.697E-5	629	0.076	0.060	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
13	PDB:7d72K	0.203	0.260	3.551E-3	360	0.046	0.064	7d72K.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
14	PDB:3zmoA	0.120	0.266	5.381E-3	172	0.038	0.110	3zmoA.pdb.gz
15	PDB:6fxrA	0.175	0.130	1.034E-2	700	0.034	0.024	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
16	PDB:1h5sB	0.193	0.293	1.987E-2	291	0.050	0.086	1h5sB.pdb.gz	Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.
17	PDB:6r8uA	0.194	0.223	2.674E-2	425	0.038	0.045	6r8uA.pdb.gz	The allosteric control mechanism of bacterial glycogen biosynthesis disclosed by cryoEM
18	PDB:5h4bA	0.131	0.357	2.837E-2	136	0.030	0.110	5h4bA.pdb.gz
19	PDB:7l70I	0.186	0.359	3.391E-2	215	0.048	0.112	7l70I.pdb.gz
20	PDB:1mc3A	0.211	0.324	3.598E-2	291	0.032	0.055	1mc3A.pdb.gz	Crystal Structure of Escherichia coli Glucose-1-Phosphate Thymidylyltransferase (RffH) Complexed with dTTP and Mg2+

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NCR0	0.0	1036	500	1.000	1.000	B3GL2_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALNT2 PE=1 SV=1
2	Q502B3	2.10e-177	509	491	0.526	0.536	B3GL2_DANRE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Danio rerio OX=7955 GN=b3galnt2 PE=2 SV=1
3	F4JIK9	2.20e-22	103	741	0.124	0.084	F4JIK9_ARATH Galactosyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
4	A7XDQ9	2.96e-22	102	684	0.124	0.091	B3GTK_ARATH Hydroxyproline O-galactosyltransferase GALT2 OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
5	Q8GXG6	4.11e-21	99.0	673	0.130	0.097	B3GTH_ARATH Hydroxyproline O-galactosyltransferase GALT4 OS=Arabidopsis thaliana OX=3702 GN=GALT4 PE=2 SV=2
6	Q8RX55	4.34e-19	92.8	672	0.130	0.097	B3GTI_ARATH Hydroxyproline O-galactosyltransferase GALT5 OS=Arabidopsis thaliana OX=3702 GN=GALT5 PE=1 SV=1
7	Q9LV16	2.92e-18	90.5	681	0.118	0.087	B3GTJ_ARATH Hydroxyproline O-galactosyltransferase GALT6 OS=Arabidopsis thaliana OX=3702 GN=GALT6 PE=2 SV=2
8	Q91Z92	4.69e-17	84.3	325	0.112	0.172	B3GT6_MOUSE Beta-1,3-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B3galt6 PE=2 SV=1
9	Q96L58	1.03e-16	83.6	329	0.112	0.170	B3GT6_HUMAN Beta-1,3-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B3GALT6 PE=1 SV=2
10	A1Z7G9	9.33e-16	81.3	382	0.088	0.115	A1Z7G9_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=beta3GalTII PE=2 SV=1
11	Q9N491	7.75e-14	74.7	330	0.104	0.158	SQV2_CAEEL Beta-1,3-galactosyltransferase sqv-2 OS=Caenorhabditis elegans OX=6239 GN=sqv-2 PE=2 SV=1
12	O54904	9.30e-14	74.7	326	0.092	0.141	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
13	Q9Y5Z6	9.30e-14	74.7	326	0.092	0.141	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
14	Q8L7F9	1.13e-13	75.9	643	0.104	0.081	B3GTF_ARATH Beta-1,3-galactosyltransferase GALT1 OS=Arabidopsis thaliana OX=3702 GN=GALT1 PE=1 SV=1
15	O43825	1.16e-13	75.1	422	0.114	0.135	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
16	O54905	1.18e-13	75.1	422	0.112	0.133	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
17	O75752	1.91e-10	64.7	331	0.082	0.124	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
18	Q9ASW1	1.32e-09	62.8	619	0.096	0.078	B3GTG_ARATH Hydroxyproline O-galactosyltransferase GALT3 OS=Arabidopsis thaliana OX=3702 GN=GALT3 PE=2 SV=1
19	Q9LM60	1.50e-09	62.0	398	0.082	0.103	B3GT5_ARATH Probable beta-1,3-galactosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=B3GALT5 PE=2 SV=1
20	Q66GS2	2.71e-09	61.2	371	0.090	0.121	B3GTC_ARATH Probable beta-1,3-galactosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=B3GALT12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01762 Galactosyl_T	3e-24	97.5	Galactosyltransferase
2	PF06005 ZapB	2.5e+02	13.5	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355559

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344125	0.996	Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
2	9606.ENSP00000331258	0.993	Protein O-mannose kinase
3	9606.ENSP00000442600	0.966	Dystroglycan
4	9606.ENSP00000261234	0.897	UDP-D-xylose:ribitol-5-phosphate beta1,4-xylosyltransferase
5	9606.ENSP00000361302	0.886	Protein O-mannosyl-transferase 1
6	9606.ENSP00000361060	0.883	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
7	9606.ENSP00000309096	0.853	Beta-1,4-glucuronyltransferase 1
8	9606.ENSP00000361667	0.851	Dolichol kinase
9	9606.ENSP00000261534	0.846	Protein O-mannosyl-transferase 2
10	9606.ENSP00000326570	0.839	Fukutin-related protein
11	9606.ENSP00000223528	0.833	Fukutin
12	9606.ENSP00000309092	0.825	Mannose-1-phosphate guanyltransferase beta
13	9606.ENSP00000322181	0.824	Dolichol phosphate-mannose biosynthesis regulatory protein
14	9606.ENSP00000360644	0.810	Dolichol-phosphate mannosyltransferase subunit 1
15	9606.ENSP00000385478	0.808	D-ribitol-5-phosphate cytidylyltransferase
16	9606.ENSP00000357384	0.788	Dolichol-phosphate mannosyltransferase subunit 3
17	9606.ENSP00000029410	0.747	Beta-1,4-galactosyltransferase 7
18	9606.ENSP00000328277	0.671	N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1
19	9606.ENSP00000347088	0.661	LARGE xylosyl- and glucuronyltransferase 1
20	9606.ENSP00000432869	0.660	LARGE xylosyl- and glucuronyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008376	1.000	acetylgalactosaminyltransferase activity
GO:0008378	0.954	galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006486	0.997	protein glycosylation
GO:0006493	0.963	protein O-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.995	endoplasmic reticulum membrane
GO:0005794	0.817	Golgi apparatus
GO:0000139	0.590	Golgi membrane
GO:0043233	0.374	organelle lumen
GO:0070013	0.311	intracellular organelle lumen
GO:0005634	0.308	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]