StarFunc result for job id Q8NCR3

User Input

>input (313 residues)
MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAE
LLDAAAGIHVRFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHL
QEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRK
IEWMRQMYYSGSLEAKSTHHETLGLIHTATKGLIRAFEDGGIDSVMEWEVDEVLNWTNTL
NFDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDISKMQMGIPDDTYYENVYQEP
NVTRLTPDSTYGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCR3	1.000	1.000	5.677E-57	313	1.000	1.000	Q8NCR3.pdb.gz	MFI_HUMAN Protein MFI OS=Homo sapiens OX=9606 GN=MFI PE=1 SV=1
2	AFDB:Q9D4W2	0.813	0.808	8.875E-40	315	0.700	0.695	Q9D4W2.pdb.gz	MFI_MOUSE Protein MFI OS=Mus musculus OX=10090 GN=Mfi PE=1 SV=1
3	AFDB:Q9GZP1	0.096	0.137	5.773E-1	204	0.080	0.123	Q9GZP1.pdb.gz	NRSN2_HUMAN Neurensin-2 OS=Homo sapiens OX=9606 GN=NRSN2 PE=1 SV=1
4	AFDB:Q6NYU3	0.120	0.115	6.139E-1	327	0.105	0.101	Q6NYU3.pdb.gz	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
5	AFDB:Q9VEF5	0.082	0.060	6.139E-1	433	0.089	0.065	Q9VEF5.pdb.gz	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
6	AFDB:P27542	0.148	0.080	8.872E-1	660	0.067	0.032	P27542.pdb.gz	DNAK_CHLPN Chaperone protein DnaK OS=Chlamydia pneumoniae OX=83558 GN=dnaK PE=3 SV=1
7	AFDB:M9PBP3	0.104	0.069	1.003	602	0.112	0.058	M9PBP3.pdb.gz	M9PBP3_DROME Cdc42-interacting protein 4, isoform J OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
8	AFDB:Q09750	0.112	0.033	1.067	1522	0.109	0.022	Q09750.pdb.gz	PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst1 PE=1 SV=1
9	AFDB:O15504	0.101	0.078	1.282	423	0.125	0.092	O15504.pdb.gz	NUP42_HUMAN Nucleoporin NUP42 OS=Homo sapiens OX=9606 GN=NUP42 PE=1 SV=1
10	AFDB:Q147F2	0.097	0.073	1.542	460	0.115	0.078	Q147F2.pdb.gz	Q147F2_ARATH At1g77890 OS=Arabidopsis thaliana OX=3702 GN=ATG14A PE=1 SV=1
11	PDB:6htsE	0.091	0.071	1.998	443	0.026	0.018	6htsE.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
12	PDB:2xlqA	0.093	0.093	2.554	316	0.019	0.019	2xlqA.pdb.gz	Structure and Mechanism of the Magnesium-Independent Aromatic Prenyltransferase Cloq from the Clorobiocin Biosynthetic Pathway.
13	PDB:5oqma	0.046	0.074	2.554	149	0.035	0.074	5oqma.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
14	PDB:6v8oO	0.093	0.091	2.715	384	0.118	0.096	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
15	PDB:6ahrD	0.081	0.150	3.070	145	0.051	0.110	6ahrD.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
16	PDB:7pzyo	0.115	0.149	3.070	234	0.048	0.064	7pzyo.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:6c0fF	0.125	0.157	3.471	242	0.045	0.058	6c0fF.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
18	PDB:6j5tH	0.066	0.065	3.471	327	0.026	0.024	6j5tH.pdb.gz	Reconstitution and structure of a plant NLR resistosome conferring immunity.
19	PDB:6g0lW	0.096	0.046	3.691	878	0.080	0.028	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
20	PDB:6rkwD	0.096	0.044	3.691	781	0.026	0.010	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NCR3	0.0	658	313	1.000	1.000	MFI_HUMAN Protein MFI OS=Homo sapiens OX=9606 GN=MFI PE=1 SV=1
2	Q9D4W2	6.39e-165	463	315	0.696	0.692	MFI_MOUSE Protein MFI OS=Mus musculus OX=10090 GN=Mfi PE=1 SV=1
3	Q9VC45	0.76	34.3	1954	0.064	0.010	ASP_DROME Protein abnormal spindle OS=Drosophila melanogaster OX=7227 GN=asp PE=1 SV=3
4	O89019	1.5	33.1	1062	0.058	0.017	INVS_MOUSE Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2
5	Q9H0B3	2.3	32.7	1180	0.067	0.018	IQCN_HUMAN IQ domain-containing protein N OS=Homo sapiens OX=9606 GN=IQCN PE=1 SV=1
6	Q67XI5	3.9	30.8	152	0.051	0.105	Q67XI5_ARATH At4g20030 OS=Arabidopsis thaliana OX=3702 GN=At4g20030 PE=2 SV=1
7	Q03018	5.8	31.2	1630	0.102	0.020	ESP1_YEAST Separin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESP1 PE=1 SV=2
8	G5EB26	5.9	31.2	886	0.048	0.017	G5EB26_EMENI MAPKK kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02269 PE=3 SV=1
9	Q8IVT4	7.0	31.2	953	0.045	0.015	Q8IVT4_HUMAN Hypothetical MGC50722 OS=Homo sapiens OX=9606 GN=MGC50722 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483537

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315386	0.792	KDEL motif-containing protein 2
2	9606.ENSP00000265843	0.744	Exophilin-5
3	9606.ENSP00000278612	0.569	Protein NPAT

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0051049	0.971	regulation of transport
GO:0048523	0.957	negative regulation of cellular process
GO:0051223	0.910	regulation of protein transport
GO:0051051	0.768	negative regulation of transport
GO:0010639	0.758	negative regulation of organelle organization
GO:0033157	0.744	regulation of intracellular protein transport
GO:0009987	0.718	cellular process
GO:1903533	0.686	regulation of protein targeting
GO:1903828	0.651	negative regulation of protein localization
GO:1904950	0.641	negative regulation of establishment of protein localization
GO:0051224	0.603	negative regulation of protein transport
GO:0010821	0.582	regulation of mitochondrion organization
GO:0010823	0.567	negative regulation of mitochondrion organization
GO:1903747	0.530	regulation of establishment of protein localization to mitochondrion
GO:0090140	0.530	regulation of mitochondrial fission
GO:0090317	0.469	negative regulation of intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031968	0.998	organelle outer membrane
GO:0031966	0.995	mitochondrial membrane
GO:0005741	0.994	mitochondrial outer membrane
GO:0012505	0.865	endomembrane system
GO:0005634	0.697	nucleus
GO:0070013	0.545	intracellular organelle lumen
GO:0031981	0.522	nuclear lumen
GO:0005654	0.509	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]