StarFunc result for job id Q8NCT1

User Input

>input (418 residues)
MGGEAGCAAAVGAEGRVKSLGLVFEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQ
GRATAAWGPSTCPRASASTAALAVFSEVEYLNVRLSLREPPAGEGIILLQPGKHEFPFRF
QLPSEPLVTSFTGKYGSIQYCVRAVLERPKVPDQSVKRELQVVSHVDVNTPALLTPVLKT
QEKMVGCWFFTSGPVSLSAKIERKGYCNGEAIPIYAEIENCSSRLIVPKAAIFQTQTYLA
SGKTKTIRHMVANVRGNHIASGSTDTWNGKTLKIPPVTPSILDCCIIRVDYSLAVYIHIP
GAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEE
EFSRHIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQPVSFIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RC80	0.792	0.792	8.533E-69	418	1.000	1.000	A0A024RC80.pdb.gz
2	AFDB:A0A0B4J1F4	0.766	0.771	1.427E-62	415	0.861	0.867	A0A0B4J1F4.pdb.gz	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
3	AFDB:Q7TPQ9	0.721	0.728	1.834E-45	414	0.510	0.514	Q7TPQ9.pdb.gz	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
4	AFDB:Q8TBH0	0.723	0.741	1.571E-40	407	0.450	0.462	Q8TBH0.pdb.gz	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
5	AFDB:Q8BG60	0.671	0.705	4.710E-38	397	0.411	0.433	Q8BG60.pdb.gz	TXNIP_MOUSE Thioredoxin-interacting protein OS=Mus musculus OX=10090 GN=Txnip PE=1 SV=1
6	AFDB:Q0E8K8	0.660	0.797	2.981E-26	342	0.215	0.263	Q0E8K8.pdb.gz	Q0E8K8_DROME FI21816p1 OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
7	AFDB:O45782	0.632	0.621	1.842E-25	426	0.213	0.209	O45782.pdb.gz	ARD17_CAEEL Arrestin domain-containing protein 17 OS=Caenorhabditis elegans OX=6239 GN=arrd-17 PE=1 SV=2
8	AFDB:Q20577	0.634	0.758	4.365E-25	346	0.230	0.277	Q20577.pdb.gz	Q20577_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-24 PE=1 SV=2
9	AFDB:Q8N5I2	0.623	0.603	6.390E-24	433	0.256	0.247	Q8N5I2.pdb.gz	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
10	AFDB:Q9XXI4	0.635	0.634	9.836E-24	419	0.230	0.229	Q9XXI4.pdb.gz	Q9XXI4_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-7 PE=1 SV=2
11	PDB:5f0jB	0.533	0.708	6.869E-15	306	0.100	0.137	5f0jB.pdb.gz
12	PDB:2r51A	0.512	0.720	2.165E-13	288	0.112	0.163	2r51A.pdb.gz
13	PDB:5tv1A	0.445	0.535	5.382E-13	337	0.124	0.154	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
14	PDB:2wtrB	0.444	0.499	6.840E-13	367	0.136	0.155	2wtrB.pdb.gz
15	PDB:3gc3A	0.439	0.542	7.160E-12	329	0.132	0.167	3gc3A.pdb.gz
16	PDB:5w0pC	0.383	0.210	2.055E-11	850	0.132	0.065	5w0pC.pdb.gz
17	PDB:7jsmB	0.448	0.483	4.020E-11	383	0.112	0.123	7jsmB.pdb.gz
18	PDB:3gd1E	0.404	0.542	1.772E-9	300	0.134	0.187	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
19	PDB:6kzbC	0.192	0.134	3.444E-6	649	0.072	0.046	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
20	PDB:5mhlA	0.152	0.105	7.779E-6	692	0.074	0.045	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1F4	0.0	744	415	0.861	0.867	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
2	Q8NCT1	0.0	856	418	1.000	1.000	ARRD4_HUMAN Arrestin domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ARRDC4 PE=1 SV=3
3	Q96B67	6.64e-146	423	414	0.507	0.512	ARRD3_HUMAN Arrestin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARRDC3 PE=1 SV=1
4	Q7TPQ9	3.73e-140	408	414	0.510	0.514	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
5	Q8TBH0	6.98e-118	351	407	0.455	0.467	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
6	Q9H3M7	5.50e-113	338	391	0.428	0.458	TXNIP_HUMAN Thioredoxin-interacting protein OS=Homo sapiens OX=9606 GN=TXNIP PE=1 SV=1
7	Q8BG60	3.39e-110	331	397	0.409	0.431	TXNIP_MOUSE Thioredoxin-interacting protein OS=Mus musculus OX=10090 GN=Txnip PE=1 SV=1
8	Q5M7W1	4.31e-110	331	394	0.419	0.444	TXNIP_RAT Thioredoxin-interacting protein OS=Rattus norvegicus OX=10116 GN=Txnip PE=2 SV=1
9	O45782	2.43e-24	106	426	0.187	0.183	ARD17_CAEEL Arrestin domain-containing protein 17 OS=Caenorhabditis elegans OX=6239 GN=arrd-17 PE=1 SV=2
10	Q8SYE1	1.15e-23	103	342	0.211	0.257	Q8SYE1_DROME RE65532p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
11	Q20577	1.20e-23	103	346	0.211	0.254	Q20577_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-24 PE=1 SV=2
12	Q0E8K8	2.39e-23	102	342	0.211	0.257	Q0E8K8_DROME FI21816p1 OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
13	Q8N5I2	7.30e-23	102	433	0.218	0.210	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
14	Q9XXI4	3.66e-21	97.1	419	0.206	0.205	Q9XXI4_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-7 PE=1 SV=2
15	Q8SYW4	1.10e-18	87.4	271	0.170	0.262	Q8SYW4_DROME RE30730p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
16	Q8SYU5	1.14e-13	74.7	469	0.175	0.156	Q8SYU5_DROME RE33762p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10086 PE=1 SV=1
17	Q9VGU4	5.57e-07	53.9	520	0.120	0.096	Q9VGU4_DROME FI02822p OS=Drosophila melanogaster OX=7227 GN=Leash PE=2 SV=2
18	Q55CH0	1.50e-06	52.8	654	0.127	0.081	ADCC_DICDI Arrestin domain-containing protein C OS=Dictyostelium discoideum OX=44689 GN=adcC PE=3 SV=1
19	Q09889	0.001	43.5	594	0.110	0.077	YC9F_SCHPO Arrestin domain-containing protein C584.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC584.15c PE=1 SV=1
20	P53179	0.004	41.6	542	0.100	0.077	PALF_YEAST pH-response regulator protein palF/RIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02752 Arrestin_C	1.6e-18	79.0	Arrestin (or S-antigen), C-terminal domain
2	PF00339 Arrestin_N	9.6e-32	121.5	Arrestin (or S-antigen), N-terminal domain
3	PF08737 Rgp1	3.3e+02	11.8	Rgp1
4	PF03643 Vps26	64	14.0	Vacuolar protein sorting-associated protein 26

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383199	0.756	E3 ubiquitin-protein ligase NEDD4-like
2	9606.ENSP00000362480	0.751	Vacuolar protein sorting-associated protein 26A
3	9606.ENSP00000311399	0.705	Down syndrome critical region gene 3
4	9606.ENSP00000424126	0.690	Multiple C2 and transmembrane domain-containing protein 1
5	9606.ENSP00000281187	0.687	Vacuolar protein sorting-associated protein 26B
6	9606.ENSP00000386444	0.679	S-arrestin
7	9606.ENSP00000311538	0.675	Arrestin-C
8	9606.ENSP00000312834	0.644	MLX-interacting protein
9	9606.ENSP00000363641	0.625	Thioredoxin
10	9606.ENSP00000263642	0.597	Interferon-induced helicase C domain-containing protein 1
11	9606.ENSP00000350377	0.589	Multiple C2 and transmembrane domain-containing protein 2
12	9606.ENSP00000246912	0.584	Max-like protein X
13	9606.ENSP00000409581	0.578	Beta-arrestin-1
14	9606.ENSP00000424827	0.565	E3 ubiquitin-protein ligase NEDD4
15	9606.ENSP00000352069	0.552	NEDD4-like E3 ubiquitin-protein ligase WWP2
16	9606.ENSP00000269383	0.551	Tripartite motif containing 65
17	9606.ENSP00000403701	0.550	Beta-arrestin-2
18	9606.ENSP00000301021	0.527	Trafficking protein particle complex subunit 2-like protein
19	9606.ENSP00000368199	0.518	Pyroglutamyl-peptidase 1-like protein
20	9606.ENSP00000480499	0.517	E3 ubiquitin-protein ligase Itchy homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060090	0.383	molecular adaptor activity
GO:0030674	0.369	protein-macromolecule adaptor activity
GO:0019899	0.342	enzyme binding
GO:0140767	0.315	enzyme-substrate adaptor activity
GO:1990756	0.313	ubiquitin ligase-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0019222	0.992	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0048518	0.958	positive regulation of biological process
GO:0009987	0.936	cellular process
GO:0050794	0.882	regulation of cellular process
GO:1903320	0.857	regulation of protein modification by small protein conjugation or removal
GO:0065009	0.850	regulation of molecular function
GO:0071704	0.839	organic substance metabolic process
GO:0051338	0.825	regulation of transferase activity
GO:0051247	0.823	positive regulation of protein metabolic process
GO:0044238	0.815	primary metabolic process
GO:0006807	0.779	nitrogen compound metabolic process
GO:0051179	0.756	localization
GO:0051438	0.736	regulation of ubiquitin-protein transferase activity
GO:0031401	0.734	positive regulation of protein modification process
GO:0031396	0.718	regulation of protein ubiquitination
GO:0043170	0.639	macromolecule metabolic process
GO:0043085	0.628	positive regulation of catalytic activity
GO:1901564	0.618	organonitrogen compound metabolic process
GO:0019538	0.580	protein metabolic process
GO:0051234	0.516	establishment of localization
GO:0031398	0.470	positive regulation of protein ubiquitination
GO:0070647	0.457	protein modification by small protein conjugation or removal
GO:0048522	0.454	positive regulation of cellular process
GO:0006810	0.448	transport
GO:0048519	0.434	negative regulation of biological process
GO:0031323	0.423	regulation of cellular metabolic process
GO:0032446	0.368	protein modification by small protein conjugation
GO:0048523	0.345	negative regulation of cellular process
GO:0016567	0.319	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0012505	0.995	endomembrane system
GO:0005737	0.992	cytoplasm
GO:0031982	0.822	vesicle
GO:0031410	0.705	cytoplasmic vesicle
GO:0005634	0.588	nucleus
GO:0005829	0.329	cytosol
GO:0005768	0.321	endosome
GO:1903561	0.308	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]