StarFunc result for job id Q8NCW5

User Input

>input (288 residues)
MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYL
SQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNN
GGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELY
ELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLIS
LTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCW5	1.000	1.000	1.217E-61	288	1.000	1.000	Q8NCW5.pdb.gz	NNRE_HUMAN NAD(P)H-hydrate epimerase OS=Homo sapiens OX=9606 GN=NAXE PE=1 SV=2
2	AFDB:Q0PIT9	0.833	0.833	1.455E-57	288	0.899	0.899	Q0PIT9.pdb.gz	NNRE_PIG NAD(P)H-hydrate epimerase OS=Sus scrofa OX=9823 GN=NAXE PE=2 SV=1
3	AFDB:Q8K4Z3	0.824	0.841	1.235E-55	282	0.878	0.897	Q8K4Z3.pdb.gz	NNRE_MOUSE NAD(P)H-hydrate epimerase OS=Mus musculus OX=10090 GN=Naxe PE=1 SV=1
4	PDB:3rnoA	0.807	0.997	4.006E-48	233	0.767	0.948	3rnoA.pdb.gz	Identification of unknown protein function using metabolite cocktail screening.
5	AFDB:Q6DHK1	0.892	0.907	2.138E-47	283	0.681	0.693	Q6DHK1.pdb.gz	NNRE_DANRE NAD(P)H-hydrate epimerase OS=Danio rerio OX=7955 GN=naxe PE=1 SV=1
6	AFDB:Q1LVI2	0.798	0.931	2.568E-33	246	0.410	0.480	Q1LVI2.pdb.gz	YJEN3_DANRE YjeF N-terminal domain-containing 3 OS=Danio rerio OX=7955 GN=yjefn3 PE=1 SV=1
7	AFDB:Q9LTX3	0.770	0.423	4.266E-33	530	0.458	0.249	Q9LTX3.pdb.gz	PPOX1_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPOX1 PE=1 SV=1
8	AFDB:A6XGL0	0.782	0.754	8.106E-30	299	0.431	0.415	A6XGL0.pdb.gz	YJEN3_HUMAN YjeF N-terminal domain-containing protein 3 OS=Homo sapiens OX=9606 GN=YJEFN3 PE=1 SV=1
9	AFDB:Q6FT51	0.756	0.880	1.704E-28	246	0.375	0.439	Q6FT51.pdb.gz	Q6FT51_CANGA NAD(P)H-hydrate epimerase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G05357g PE=3 SV=1
10	AFDB:O13725	0.734	0.869	6.456E-28	242	0.382	0.455	O13725.pdb.gz	NNRE_SCHPO NAD(P)H-hydrate epimerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug182 PE=1 SV=1
11	AFDB:P40165	0.765	0.892	9.273E-27	246	0.344	0.402	P40165.pdb.gz	NNRE_YEAST NAD(P)H-hydrate epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNR1 PE=1 SV=1
12	PDB:1jztA	0.761	0.898	1.094E-26	243	0.347	0.412	1jztA.pdb.gz
13	PDB:1f8gA	0.261	0.208	2.424E-4	382	0.101	0.076	1f8gA.pdb.gz	Protein-protein recognition, hydride transfer and proton pumping in the transhydrogenase complex.
14	PDB:2b5wA	0.301	0.252	5.189E-4	357	0.094	0.076	2b5wA.pdb.gz	Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei.
15	PDB:2cd9A	0.281	0.232	7.593E-4	363	0.083	0.066	2cd9A.pdb.gz	The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
16	PDB:1u2gB	0.268	0.226	1.344E-3	359	0.080	0.064	1u2gB.pdb.gz	Active-site conformational changes associated with hydride transfer in proton-translocating transhydrogenase.
17	PDB:2vhyB	0.273	0.242	1.344E-3	330	0.083	0.073	2vhyB.pdb.gz
18	PDB:4rvuA	0.280	0.251	1.344E-3	329	0.111	0.097	4rvuA.pdb.gz	Structural views of quinone oxidoreductase from Mycobacterium tuberculosis reveal large conformational changes induced by the co-factor.
19	PDB:1a7aA	0.259	0.190	2.095E-3	431	0.090	0.060	1a7aA.pdb.gz	Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.
20	PDB:4j1tE	0.276	0.224	2.535E-3	373	0.104	0.080	4j1tE.pdb.gz	Crystal structure analysis of Thermus thermophilus transhydrogenase soluble domains

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0BNM1	0.0	502	282	0.844	0.862	NNRE_RAT NAD(P)H-hydrate epimerase OS=Rattus norvegicus OX=10116 GN=Naxe PE=2 SV=1
2	Q0PIT9	0.0	516	288	0.861	0.861	NNRE_PIG NAD(P)H-hydrate epimerase OS=Sus scrofa OX=9823 GN=NAXE PE=2 SV=1
3	Q8NCW5	0.0	593	288	1.000	1.000	NNRE_HUMAN NAD(P)H-hydrate epimerase OS=Homo sapiens OX=9606 GN=NAXE PE=1 SV=2
4	Q8K4Z3	8.94e-180	498	282	0.840	0.858	NNRE_MOUSE NAD(P)H-hydrate epimerase OS=Mus musculus OX=10090 GN=Naxe PE=1 SV=1
5	Q6DHK1	3.65e-135	385	283	0.681	0.693	NNRE_DANRE NAD(P)H-hydrate epimerase OS=Danio rerio OX=7955 GN=naxe PE=1 SV=1
6	Q1LVI2	6.37e-83	251	246	0.410	0.480	YJEN3_DANRE YjeF N-terminal domain-containing 3 OS=Danio rerio OX=7955 GN=yjefn3 PE=1 SV=1
7	A6XGL0	5.13e-75	233	299	0.399	0.385	YJEN3_HUMAN YjeF N-terminal domain-containing protein 3 OS=Homo sapiens OX=9606 GN=YJEFN3 PE=1 SV=1
8	Q9LTX3	2.37e-73	236	530	0.427	0.232	PPOX1_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPOX1 PE=1 SV=1
9	O13725	1.55e-64	204	242	0.378	0.450	NNRE_SCHPO NAD(P)H-hydrate epimerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug182 PE=1 SV=1
10	Q6FT51	1.80e-58	189	246	0.375	0.439	Q6FT51_CANGA NAD(P)H-hydrate epimerase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G05357g PE=3 SV=1
11	P40165	1.99e-51	171	246	0.344	0.402	NNRE_YEAST NAD(P)H-hydrate epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNR1 PE=1 SV=1
12	P31806	4.08e-13	71.2	515	0.212	0.118	NNR_ECOLI Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Escherichia coli (strain K12) OX=83333 GN=nnr PE=1 SV=2
13	Q5AXT7	0.001	42.7	698	0.177	0.073	Q5AXT7_EMENI Enhancer of mRNA-decapping protein 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06893 PE=3 SV=1
14	O94752	0.045	37.4	454	0.087	0.055	EDC3_SCHPO Enhancer of mRNA-decapping protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=edc3 PE=1 SV=1
15	H3BPN4	0.048	37.0	213	0.069	0.094	H3BPN4_HUMAN YjeF domain-containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1
16	Q96F86	0.049	37.4	508	0.094	0.053	EDC3_HUMAN Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1
17	B1AR51	0.75	33.9	4484	0.087	0.006	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
18	F7DC70	0.89	33.9	1958	0.087	0.013	F7DC70_MOUSE Dynein, axonemal, heavy chain 9 (Fragment) OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
19	P77544	2.0	32.0	214	0.073	0.098	YFCF_ECOLI Glutathione S-transferase YfcF OS=Escherichia coli (strain K12) OX=83333 GN=yfcF PE=1 SV=1
20	Q1LUM9	4.3	31.2	501	0.073	0.042	Q1LUM9_DANRE Dynein light intermediate chain OS=Danio rerio OX=7955 GN=dncli2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03853 YjeF_N	1.4e-33	127.8	YjeF-related protein N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311984	0.993	ATP-dependent (S)-NAD(P)H-hydrate dehydratase
2	9606.ENSP00000229239	0.903	Glyceraldehyde-3-phosphate dehydrogenase
3	9606.ENSP00000236850	0.893	Apolipoprotein A-I
4	9606.ENSP00000478754	0.797	Probable ATP-dependent RNA helicase DDX6
5	9606.ENSP00000373715	0.782	m7GpppN-mRNA hydrolase
6	9606.ENSP00000225573	0.767	Pyridoxine-5'-phosphate oxidase
7	9606.ENSP00000216962	0.745	Glycogen phosphorylase, brain form
8	9606.ENSP00000263816	0.739	Low-density lipoprotein receptor-related protein 2
9	9606.ENSP00000410833	0.731	1,4-alpha-glucan-branching enzyme
10	9606.ENSP00000266483	0.693	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
11	9606.ENSP00000310120	0.689	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
12	9606.ENSP00000301838	0.688	FAS-associated death domain protein
13	9606.ENSP00000280665	0.668	mRNA-decapping enzyme 1B
14	9606.ENSP00000476046	0.668	mRNA-decapping enzyme 1A
15	9606.ENSP00000225567	0.662	Golgi SNAP receptor complex member 2
16	9606.ENSP00000313432	0.651	Glyoxylate reductase/hydroxypyruvate reductase
17	9606.ENSP00000265969	0.649	Potassium voltage-gated channel subfamily C member 1
18	9606.ENSP00000297994	0.643	tRNA methyltransferase 10 homolog B
19	9606.ENSP00000294724	0.629	Glycogen debranching enzyme
20	9606.ENSP00000345464	0.585	E3 ubiquitin-protein ligase NHLRC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.656	identical protein binding
GO:0003824	0.596	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0019362	0.992	pyridine nucleotide metabolic process
GO:1905952	0.982	regulation of lipid localization
GO:0048856	0.964	anatomical structure development
GO:0046496	0.960	nicotinamide nucleotide metabolic process
GO:0048519	0.957	negative regulation of biological process
GO:0009653	0.938	anatomical structure morphogenesis
GO:0032501	0.937	multicellular organismal process
GO:0071840	0.753	cellular component organization or biogenesis
GO:0016043	0.714	cellular component organization
GO:0051179	0.626	localization
GO:0050793	0.603	regulation of developmental process
GO:0007275	0.591	multicellular organism development
GO:0032374	0.575	regulation of cholesterol transport
GO:0048514	0.575	blood vessel morphogenesis
GO:0001525	0.563	angiogenesis
GO:0022603	0.558	regulation of anatomical structure morphogenesis
GO:0051239	0.547	regulation of multicellular organismal process
GO:0010874	0.531	regulation of cholesterol efflux
GO:0050794	0.483	regulation of cellular process
GO:0002040	0.424	sprouting angiogenesis
GO:0051641	0.405	cellular localization
GO:0045765	0.382	regulation of angiogenesis
GO:0051093	0.378	negative regulation of developmental process
GO:0051668	0.373	localization within membrane
GO:0016525	0.369	negative regulation of angiogenesis
GO:0061024	0.364	membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005739	0.995	mitochondrion
GO:0070013	0.978	intracellular organelle lumen
GO:0005829	0.914	cytosol
GO:0031982	0.761	vesicle
GO:0070062	0.583	extracellular exosome
GO:0012505	0.332	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]