StarFunc result for job id Q8NCX0

User Input

>input (1101 residues)
MDCKVHMETTVSRPVLSPTHINATASETFTVLQQRMRIVEEQTSSLRDDLIMLDFGEKRG
YLEAPDCLEDLDSQKVISPIQNEAICAGKTDILWKNCEFLVNRMCRLESLMQSLKMNIFR
LQTEKDLNPQKTAFLKDRLNAIQEEHSKDLKLLHLEVMNLRQQLRAVKEEEDKAQDEVQR
LTATLKIASQTKKNAAIIEEELKTTKRKMNLKIQELRRQLAQEKYLRESLEKSASAMLLK
IQEMGSTVEVERKQVHILQQNCIALRDSIQSAQELLAQEQKKKEELEIATSQLKSDLTSR
DDLISKLVEENKNLQISFNKEHEENAYLRSEIMSLHEASEKAQVLNDQLTKKCSELSCML
QTVTMEKARIIADHQAILQVEQKMMTQTFQEQNLLLDAAHASITNELQTVQNEKTQLQAH
LDHLILEHNQCIQKAQDAEKRTAVQKELLESTIARLRGELEASMQEKKSLLEEKERFQRE
VNKTEKEIVQERCNLEKELAKNKVDINTLTHNLQTLEEENKHLADQMASLELQQVTSDYH
GLAQQKVEKITESKNKLAYENGKLQIKVKQLEEQVQSFTDTSLQNDHLRKMNKYLQTKYA
QANSELSAKRVHLQQADAHLKEVKSILERSKEELSRTVKCRNAALKESQKLKEDLEAVED
RENKKVGNFQRQLAEAKEDNCKVTIMLENVLASHSKMQGALEKVQIELGRRDSEIAGLKK
ERDLNQQRVQKLEAEVDQWQARMLVMEDQHNSEIESLQKALGVAREDNRKLAMSLEQALQ
TNNHLQTKLDHIQEQLESKELERQNLETFKDRMTEESKVEAELHAERIEALRKQFQTERE
TTKKVAQREVAELKKALDEANFRSVEVSRTNRELRQKLAELEKILESNKEKIKNQKTQIK
LHLSAKANNAQNIERMKQIEKELKQMELIKDQYQKKNYEQSLSIQRFVCEMTNLQKEMQM
LAKSQYDASVRNKQQELHLEAERKIRQELENRCQELEETVRHLKKCKEATENTLKEASVE
SEQITANLEEAHRWFKHRFDGLQLELTKNRLQRPSGEDRWQEKDQDVKHDVMSNQSVLHR
WERKQNLRPMPKKYHSEVQRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NCX0	1.000	1.000	0.000	1101	1.000	1.000	Q8NCX0.pdb.gz	CC150_HUMAN Coiled-coil domain-containing protein 150 OS=Homo sapiens OX=9606 GN=CCDC150 PE=1 SV=2
2	AFDB:Q7TME2	0.115	0.110	2.576E-3	1165	0.128	0.121	Q7TME2.pdb.gz	SPAG5_MOUSE Sperm-associated antigen 5 OS=Mus musculus OX=10090 GN=Spag5 PE=1 SV=1
3	AFDB:P70194	0.121	0.218	1.510E-2	548	0.057	0.115	P70194.pdb.gz	CLC4F_MOUSE C-type lectin domain family 4 member F OS=Mus musculus OX=10090 GN=Clec4f PE=1 SV=1
4	AFDB:A1Z7Z9	0.124	0.120	1.761E-2	1134	0.110	0.107	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
5	AFDB:Q38D27	0.090	0.121	1.902E-2	660	0.129	0.215	Q38D27.pdb.gz	Q38D27_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4830 PE=4 SV=1
6	AFDB:Q9LFE4	0.088	0.111	4.786E-2	853	0.114	0.147	Q9LFE4.pdb.gz	Y5673_ARATH WEB family protein At5g16730, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g16730 PE=1 SV=1
7	AFDB:Q9M8T5	0.085	0.111	5.581E-2	806	0.122	0.166	Q9M8T5.pdb.gz	Y3293_ARATH WEB family protein At3g02930, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g02930 PE=3 SV=1
8	AFDB:F4IUY1	0.096	0.125	1.204E-1	837	0.112	0.147	F4IUY1.pdb.gz	F4IUY1_ARATH CAP-gly domain linker OS=Arabidopsis thaliana OX=3702 GN=At2g39300 PE=1 SV=1
9	AFDB:A0A024RAY2	0.080	0.170	1.300E-1	430	0.059	0.151	A0A024RAY2.pdb.gz
10	AFDB:A0A2L0PR03	0.141	0.170	1.300E-1	869	0.087	0.110	A0A2L0PR03.pdb.gz
11	PDB:6qdvO	0.080	0.178	5.894	441	0.039	0.098	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
12	PDB:5m58A	0.013	0.049	6.874	230	0.004	0.017	5m58A.pdb.gz	Crystal Structure and Catalytic Mechanism of CouO, a Versatile C-Methyltransferase from Streptomyces rishiriensis.
13	PDB:7wtxt	0.035	0.243	6.874	132	0.015	0.129	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
14	PDB:7dvqR	0.041	0.152	8.657	241	0.022	0.100	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NCX0	0.0	2201	1101	1.000	1.000	CC150_HUMAN Coiled-coil domain-containing protein 150 OS=Homo sapiens OX=9606 GN=CCDC150 PE=1 SV=2
2	P25386	6.36e-04	46.6	1790	0.078	0.048	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
3	A0A1D8PN92	0.027	41.2	1948	0.078	0.044	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
4	A0A0B4K7K9	0.096	39.3	2238	0.044	0.021	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
5	A0A0B4K6V0	0.16	38.5	1781	0.044	0.027	A0A0B4K6V0_DROME Bruchpilot, isoform L OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
6	Q25B55	0.16	38.5	1740	0.044	0.028	Q25B55_DROME CAST OS=Drosophila melanogaster OX=7227 GN=brp PE=2 SV=1
7	A8DY79	0.17	38.5	1786	0.044	0.027	A8DY79_DROME Bruchpilot, isoform G OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=2
8	A1Z7V1	0.18	38.5	1740	0.044	0.028	A1Z7V1_DROME Bruchpilot, isoform D OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
9	A2AL36	0.22	38.1	2334	0.088	0.042	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
10	E9PVZ8	0.62	37.0	3238	0.040	0.014	E9PVZ8_MOUSE Golgi autoantigen, golgin subfamily b, macrogolgin 1 OS=Mus musculus OX=10090 GN=Golgb1 PE=1 SV=1
11	E9QAH1	0.66	36.6	3197	0.040	0.014	E9QAH1_MOUSE Golgi autoantigen, golgin subfamily b, macrogolgin 1 OS=Mus musculus OX=10090 GN=Golgb1 PE=1 SV=1
12	B2RWW2	0.70	36.6	3238	0.040	0.014	B2RWW2_MOUSE Golgb1 protein OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
13	P50532	0.83	36.2	1290	0.048	0.041	SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis OX=8355 GN=smc4 PE=1 SV=1
14	Q571K1	1.0	36.2	1916	0.038	0.022	Q571K1_MOUSE MKIAA4151 protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
15	Q8CGE5	1.5	35.4	1071	0.040	0.041	Q8CGE5_MOUSE Golgb1 protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
16	Q38D27	1.6	35.0	660	0.020	0.033	Q38D27_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4830 PE=4 SV=1
17	Q6PAK0	2.0	35.0	772	0.040	0.057	Q6PAK0_MOUSE Golgb1 protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
18	A0A8I6A8E0	4.8	33.9	1431	0.059	0.045	A0A8I6A8E0_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
19	Q8NB25	5.5	33.5	1140	0.022	0.021	F184A_HUMAN Protein FAM184A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=3
20	Q6P9G8	5.7	33.5	1107	0.022	0.022	Q6P9G8_HUMAN Family with sequence similarity 184, member A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07989 Cnn_1N	45	15.6	Centrosomin N-terminal motif 1
2	PF18504 Csm1_N	45	15.8	Csm1 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366050	0.726	Uncharacterized protein C9orf40
2	9606.ENSP00000477654	0.674	Lung adenoma susceptibility protein 2
3	9606.ENSP00000331298	0.655	UBA-like domain-containing protein 2
4	9606.ENSP00000313500	0.636	Uncharacterized protein C17orf53
5	9606.ENSP00000265036	0.593	DEP domain containing 1B
6	9606.ENSP00000239830	0.585	Coiled-coil domain containing 77
7	9606.ENSP00000300128	0.584	Transmembrane protein 194A
8	9606.ENSP00000330240	0.579	Coiled-coil domain containing 34
9	9606.ENSP00000252992	0.577	Centrosomal protein of 85 kDa
10	9606.ENSP00000380866	0.569	Zinc finger family member 788
11	9606.ENSP00000418086	0.554	Uncharacterized protein C3orf14
12	9606.ENSP00000355090	0.553	Rho GTPase activating protein 11A
13	9606.ENSP00000307143	0.540	Protein downstream neighbor of Son
14	9606.ENSP00000311957	0.532	Protein ZNF738
15	9606.ENSP00000364405	0.528	Zinc finger protein 367
16	9606.ENSP00000422354	0.528	Glutathione S-transferase C-terminal domain containing
17	9606.ENSP00000303482	0.524	Receptor expression-enhancing protein 4
18	9606.ENSP00000483356	0.520	RIB43A domain with coiled-coils 2
19	9606.ENSP00000410811	0.518	Fidgetin-like protein 1
20	9606.ENSP00000436557	0.505	Protocadherin alpha-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0051128	0.822	regulation of cellular component organization
GO:0071840	0.764	cellular component organization or biogenesis
GO:0006996	0.744	organelle organization
GO:0031344	0.690	regulation of cell projection organization
GO:0032501	0.682	multicellular organismal process
GO:0120035	0.611	regulation of plasma membrane bounded cell projection organization
GO:0044087	0.439	regulation of cellular component biogenesis
GO:0007276	0.431	gamete generation
GO:0060491	0.375	regulation of cell projection assembly
GO:1902017	0.358	regulation of cilium assembly
GO:0007049	0.342	cell cycle
GO:0007010	0.310	cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005856	0.988	cytoskeleton
GO:0015630	0.980	microtubule cytoskeleton
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0005815	0.971	microtubule organizing center
GO:0005634	0.967	nucleus
GO:0005737	0.927	cytoplasm
GO:0005813	0.900	centrosome
GO:0070013	0.845	intracellular organelle lumen
GO:0031981	0.821	nuclear lumen
GO:0005654	0.359	nucleoplasm
GO:0005829	0.305	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]