StarFunc result for job id Q8ND04

User Input

>input (991 residues)
MAGPVSLRDLLMGASAWMGSESPGGSPTEGGGSAAGGPEPPWREDEICVVGIFGKTALRL
NSEKFSLVNTVCDRQVFPLFRHQDPGDPGPGIRTEAGAVGEAGGAEDPGAAAGGSVRGSG
AVAEGNRTEAGSQDYSLLQAYYSQESKVLYLLLTSICDNSQLLRACRALQSGEAGGGLSL
PHAEAHEFWKHQEKLQCLSLLYLFSVCHILLLVHPTCSFDITYDRVFRALDGLRQKVLPL
LKTAIKDCPVGKDWKLNCRPCPPRLLFLFQLNGALKVEPPRNQDPAHPDKPKKHSPKRRL
QHALEDQIYRIFRKSRVLTNQSINCLFTVPANQAFVYIVPGSQEEDPVGMLLDQLRSHCT
VKDPESLLVPAPLSGPRRYQVMRQHSRQQLSFHIDSSSSSSSGQLVDFTLREFLWQHVEL
VLSKKGFDDSVGRNPQPSHFELPTYQKWISAASKLYEVAIDGKEEDLGSPTGELTSKILS
SIKVLEGFLDIDTKFSENRCQKALPMAHSAYQSNLPHNYTMTVHKNQLAQALRVYSQHAR
GPAFHKYAMQLHEDCYKFWSNGHQLCEERSLTDQHCVHKFHSLPKSGEKPEADRNPPVLY
HNSRARSTGACNCGRKQAPRDDPFDIKAANYDFYQLLEEKCCGKLDHINFPVFEPSTPDP
APAKNESSPAPPDSDADKLKEKEPQTQGESTSLSLALSLGQSTDSLGTYPADPQAGGDNP
EVHGQVEVKTEKRPNFVDRQASTVEYLPGMLHSNCPKGLLPKFSSWSLVKLGPAKSYNFH
TGLDQQGFIPGTNYLMPWDIVIRTRAEDEGDLDTNSWPAPNKAIPGKRSAVVMGRGRRRD
DIARAFVGFEYEDSRGRRFMCSGPDKVMKVMGSGPKESALKALNSDMPLYILSSSQGRGL
KPHYAQLMRLFVVVPDAPLQIILMPQVQPGPPPCPVFYPEKQEITLPPDGLWVLRFPYAY
VTERGPCFPPKENVQLMSYKVLRGVLKAVTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7pw5B	0.667	0.926	0.000	702	0.705	0.996	7pw5B.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
2	AFDB:Q8ND04	1.000	1.000	0.000	991	1.000	1.000	Q8ND04.pdb.gz	SMG8_HUMAN Nonsense-mediated mRNA decay factor SMG8 OS=Homo sapiens OX=9606 GN=SMG8 PE=1 SV=1
3	PDB:7pw4C	0.184	0.509	2.265E-4	310	0.060	0.190	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
4	PDB:7m1sA	0.135	0.203	1.918E-2	577	0.051	0.088	7m1sA.pdb.gz
5	AFDB:O15027	0.060	0.040	1.267E-1	2357	0.122	0.051	O15027.pdb.gz	SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4
6	PDB:6b3jA	0.069	0.252	1.670E-1	195	0.022	0.113	6b3jA.pdb.gz
7	AFDB:Q923B3	0.048	0.055	2.207E-1	828	0.086	0.103	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
8	AFDB:E9Q8Q6	0.044	0.033	2.333E-1	1531	0.088	0.057	E9Q8Q6.pdb.gz	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
9	AFDB:Q9SZ15	0.054	0.098	4.064E-1	421	0.059	0.138	Q9SZ15.pdb.gz	LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5 OS=Arabidopsis thaliana OX=3702 GN=LIP5 PE=1 SV=1
10	AFDB:Q9NPG3	0.048	0.044	4.541E-1	1134	0.110	0.096	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
11	AFDB:A0A2K7P776	0.059	0.065	4.800E-1	867	0.100	0.114	A0A2K7P776.pdb.gz	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
12	AFDB:Q6DRL4	0.048	0.031	5.074E-1	1824	0.081	0.044	Q6DRL4.pdb.gz	TICRR_DANRE Treslin OS=Danio rerio OX=7955 GN=ticrr PE=2 SV=1
13	AFDB:A0A1D8PRB9	0.056	0.053	5.669E-1	1045	0.065	0.061	A0A1D8PRB9.pdb.gz	A0A1D8PRB9_CANAL Arf family guanine nucleotide exchange factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C703480WA PE=4 SV=1
14	PDB:2xtzA	0.072	0.161	5.983E-1	343	0.024	0.070	2xtzA.pdb.gz	The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
15	PDB:4zi2A	0.087	0.336	5.983E-1	185	0.026	0.141	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
16	AFDB:P21675	0.056	0.036	5.992E-1	1872	0.117	0.062	P21675.pdb.gz	TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens OX=9606 GN=TAF1 PE=1 SV=3
17	PDB:6ukaA	0.071	0.276	6.685E-1	177	0.024	0.136	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
18	PDB:7e8tL	0.098	0.323	1.102	194	0.024	0.124	7e8tL.pdb.gz
19	PDB:7et31	0.059	0.145	1.102	285	0.027	0.095	7et31.pdb.gz	Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
20	PDB:2h57B	0.077	0.307	1.375	167	0.019	0.114	2h57B.pdb.gz	Crystal structure of human ADP-ribosylation factor-like 6 (CASP Target)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8ND04	0.0	2053	991	1.000	1.000	SMG8_HUMAN Nonsense-mediated mRNA decay factor SMG8 OS=Homo sapiens OX=9606 GN=SMG8 PE=1 SV=1
2	O62301	1.41e-26	119	873	0.121	0.137	SMG8_CAEEL Nonsense-mediated mRNA decay factor SMG8 OS=Caenorhabditis elegans OX=6239 GN=smg-8 PE=1 SV=3
3	Q96JG9	1.8	35.0	3925	0.044	0.011	ZN469_HUMAN Zinc finger protein 469 OS=Homo sapiens OX=9606 GN=ZNF469 PE=2 SV=3
4	D3YT54	3.2	33.9	611	0.021	0.034	D3YT54_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=srgp-1 PE=1 SV=1
5	Q9V3E7	4.8	33.1	266	0.021	0.079	Q9V3E7_DROME LD24793p OS=Drosophila melanogaster OX=7227 GN=Ref1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10220 Smg8_Smg9	0	1204.6	Smg8_Smg9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438748

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270066	0.999	Protein SMG9
2	9606.ENSP00000402515	0.999	Serine/threonine-protein kinase SMG1
3	9606.ENSP00000355261	0.911	Protein SMG5
4	9606.ENSP00000470142	0.890	Regulator of nonsense transcripts 1
5	9606.ENSP00000425133	0.882	Protein SMG7
6	9606.ENSP00000348708	0.881	Regulator of nonsense transcripts 2
7	9606.ENSP00000263073	0.879	Telomerase-binding protein EST1A
8	9606.ENSP00000364448	0.846	Regulator of nonsense transcripts 3A
9	9606.ENSP00000331907	0.838	Probable ATP-dependent RNA helicase DHX34
10	9606.ENSP00000353741	0.827	Eukaryotic peptide chain release factor subunit 1
11	9606.ENSP00000398131	0.822	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
12	9606.ENSP00000276201	0.793	Regulator of nonsense transcripts 3B
13	9606.ENSP00000463058	0.738	RNA-binding protein 8A
14	9606.ENSP00000281513	0.719	Neuroblastoma-amplified sequence
15	9606.ENSP00000364289	0.702	Nuclear cap-binding protein subunit 1
16	9606.ENSP00000264645	0.674	Protein CASC3
17	9606.ENSP00000334840	0.674	Proline-rich nuclear receptor coactivator 2
18	9606.ENSP00000264951	0.650	5'-3' exoribonuclease 1
19	9606.ENSP00000295797	0.645	Protein kinase C iota type
20	9606.ENSP00000352265	0.640	Tubulin polyglutamylase complex subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0043170	0.992	macromolecule metabolic process
GO:0006139	0.988	nucleobase-containing compound metabolic process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0000184	0.981	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0080090	0.974	regulation of primary metabolic process
GO:0051246	0.964	regulation of protein metabolic process
GO:0031323	0.958	regulation of cellular metabolic process
GO:0051174	0.903	regulation of phosphorus metabolic process
GO:0019220	0.866	regulation of phosphate metabolic process
GO:0065009	0.850	regulation of molecular function
GO:0050790	0.663	regulation of catalytic activity
GO:0051338	0.536	regulation of transferase activity
GO:0042325	0.500	regulation of phosphorylation
GO:0043549	0.469	regulation of kinase activity
GO:0001932	0.468	regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.914	intracellular organelle
GO:0032991	0.850	protein-containing complex
GO:0043231	0.841	intracellular membrane-bounded organelle
GO:0043232	0.664	intracellular non-membrane-bounded organelle
GO:0070013	0.556	intracellular organelle lumen
GO:0031981	0.553	nuclear lumen
GO:0005654	0.482	nucleoplasm
GO:0016020	0.301	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]