StarFunc result for job id Q8ND23

User Input

>input (1372 residues)
MAKPSVELTRELQDSIRRCLSQGAVLQQHHVKLETKPKKFEDRVLALTSWRLHLFLLKVP
AKVESSFNVLEIRAFNTLSQNQILVETERGMVSMRLPSAESVDQVTRHVSSALSKVCPGP
GCLIRRGNADTPEGPRDTSPNSETSTSTTHSVCGGFSETYAALCDYNGLHCREEVQWDVD
TIYHAEDNREFNLLDFSHLESRDLALMVAALAYNQWFTKLYCKDLRLGSEVLEQVLHTLS
KSGSLEELVLDNAGLKTDFVQKLAGVFGENGSCVLHALTLSHNPIEDKGFLSLSQQLLCF
PSGLTKLCLAKTAISPRGLQALGQTFGANPAFASSLRYLDLSKNPGLLATDEANALYSFL
AQPNALVHLDLSGTDCVIDLLLGALLHGCCSHLTYLNLARNSCSHRKGREAPPAFKQFFS
SAYTLSHVNLSATKLPLEALRALLQGLSLNSHLSDLHLDLSSCELRSAGAQALQEQLGAV
TCVGSLDLSDNGFDSDLLTLVPALGKNKSLKHLFLGKNFNVKAKTLEEILHKLVQLIQEE
DCSLQSLSVADSRLKLRTSILINALGSNTCLAKVDLSGNGMEDIGAKMLSKALQINSSLR
TILWDRNNTSALGFLDIARALESNHTLRFMSFPVSDISQAYRSAPERTEDVWQKIQWCLV
RNNHSQTCPQEQAFRLQQGLVTSSAEQMLQRLCGRVQEEVRALRLCPLEPVQDELLYARD
LIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKELQVILESMVSLTQE
LCPVAMRVAEGHNKMLSNVAERVTVPRNFIRGALLEQAGQDIQNKLDEVKLSVVTYLTSS
IVDEILQELYHSHKSLARHLTQLRTLSDPPGCPGQGQDLSSRGRGRNHDHEETTDDELGT
NIDTMAIKKQKRCRKIRPVSAFISGSPQDMESQLGNLGIPPGWFSGLGGSQPTASGSWEG
LSELPTHGYKLRHQTQGRPRPPRTTPPGPGRPSMPAPGTRQENGMATRLDEGLEDFFSRR
VLEESSSYPRTLRTVRPGLSEAPLPPLQKKRRRGLFHFRRPRSFKGDRGPGSPTTGLLLP
PPPPPPPTQESPPSPDPPSLGNNSSPCWSPEEESSLLPGFGGGRGPSFRRKMGTEGSEPG
EGGPAPGTAQQPRVHGVALPGLERAKGWSFDGKREGPGPDQEGSTQAWQKRRSSDDAGPG
SWKPPPPPQSTKPSFSAMRRAEATWHIAEESAPNHSCQSPSPASQDGEEEKEGTLFPERT
LPARNAKLQDPALAPWPPKPVAVPRGRQPPQEPGVREEAEAGDAAPGVNKPRLRLSSQQD
QEEPEVQGPPDPGRRTAPLKPKRTRRAQSCDKLEPDRRRPPDPTGTSEPGTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8ND23	0.999	0.999	0.000	1372	1.000	1.000	Q8ND23.pdb.gz	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
2	AFDB:Q5VZK9	0.463	0.464	2.213E-91	1371	0.386	0.387	Q5VZK9.pdb.gz	CARL1_HUMAN F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1
3	AFDB:Q6EDY6	0.466	0.466	8.738E-89	1374	0.382	0.381	Q6EDY6.pdb.gz	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2
4	AFDB:Q6F5E8	0.470	0.450	8.726E-83	1435	0.367	0.351	Q6F5E8.pdb.gz	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
5	AFDB:A0A0B4KEE7	0.569	0.528	1.534E-73	1486	0.311	0.287	A0A0B4KEE7.pdb.gz	A0A0B4KEE7_DROME Leucine-rich repeat, isoform F OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
6	PDB:1a4yA	0.260	0.701	3.299E-12	460	0.070	0.209	1a4yA.pdb.gz
7	PDB:6o60C	0.197	0.534	2.160E-8	389	0.052	0.183	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
8	PDB:7pzcA	0.190	0.247	8.091E-7	1010	0.071	0.096	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
9	PDB:6npyA	0.191	0.308	4.132E-6	798	0.064	0.110	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
10	PDB:3oglB	0.185	0.367	7.789E-6	568	0.049	0.118	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
11	PDB:4kxfP	0.196	0.276	8.150E-6	866	0.063	0.099	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
12	PDB:1k5dC	0.191	0.652	1.070E-5	344	0.042	0.166	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
13	PDB:2p1nB	0.175	0.340	1.070E-5	571	0.058	0.140	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
14	PDB:7lfhA	0.202	0.328	1.469E-5	806	0.063	0.107	7lfhA.pdb.gz
15	PDB:7sa1B	0.206	0.392	5.220E-5	624	0.060	0.133	7sa1B.pdb.gz
16	AFDB:Q80TH2	0.155	0.152	3.823E-4	1402	0.130	0.128	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
17	AFDB:Q96RT1	0.131	0.128	6.013E-4	1412	0.117	0.114	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
18	AFDB:Q9VUH6	0.079	0.064	6.888E-4	1833	0.109	0.082	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
19	AFDB:Q57ZA6	0.060	0.056	1.241E-3	1572	0.126	0.110	Q57ZA6.pdb.gz	Q57ZA6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1020 PE=4 SV=1
20	AFDB:Q6PR54	0.060	0.046	1.359E-3	2419	0.126	0.072	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V3V9	0.0	611	1296	0.257	0.272	CARL2_MOUSE Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Mus musculus OX=10090 GN=Carmil2 PE=1 SV=2
2	Q5VZK9	0.0	860	1371	0.361	0.361	CARL1_HUMAN F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1
3	Q6EDY6	0.0	829	1374	0.350	0.349	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2
4	Q6F5E8	0.0	647	1435	0.272	0.260	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
5	Q8ND23	0.0	2796	1372	1.000	1.000	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
6	E1JGZ7	6.95e-177	563	1296	0.238	0.252	E1JGZ7_DROME Leucine-rich repeat, isoform G OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=2
7	E1JGZ8	1.70e-175	562	1429	0.238	0.228	E1JGZ8_DROME Leucine-rich repeat, isoform C OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
8	A1Z734	1.14e-172	555	1452	0.235	0.222	A1Z734_DROME Leucine-rich repeat, isoform B OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=2
9	A0A0B4KEE7	1.62e-171	553	1486	0.241	0.222	A0A0B4KEE7_DROME Leucine-rich repeat, isoform F OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
10	Q21301	1.06e-85	305	1056	0.157	0.205	Q21301_CAEEL CARMIL pleckstrin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=crml-1 PE=1 SV=2
11	Q95VZ3	3.98e-71	261	1050	0.153	0.200	CARML_DICDI Protein CARMIL OS=Dictyostelium discoideum OX=44689 GN=carmil PE=1 SV=1
12	Q54G18	5.18e-46	183	1115	0.131	0.161	GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum OX=44689 GN=gacW PE=3 SV=1
13	Q54B43	1.28e-28	127	861	0.122	0.194	Q54B43_DICDI Leucine-rich repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293920 PE=4 SV=1
14	H3BLT9	3.22e-13	77.4	1112	0.100	0.123	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
15	C3VPR7	1.44e-12	75.1	1065	0.100	0.129	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
16	Q7RTR2	1.44e-12	75.1	1065	0.100	0.129	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
17	Q5DU56	6.60e-10	66.2	1064	0.094	0.121	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
18	Q57ZL7	6.40e-08	59.7	759	0.071	0.129	Q57ZL7_TRYB2 Ribonuclease inhibitor-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.410 PE=4 SV=1
19	Q93ZV8	2.98e-06	54.3	605	0.075	0.170	Q93ZV8_ARATH RNI-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2004 PE=1 SV=1
20	Q384D3	6.06e-06	53.1	713	0.054	0.104	Q384D3_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0680 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16000 CARMIL_C	8.6e-73	257.1	CARMIL C-terminus
2	PF17888 Carm_PH	7.8e-24	95.2	Carmil pleckstrin homology domain
3	PF00560 LRR_1	2.6e+02	13.6	Leucine Rich Repeat
4	PF13516 LRR_6	0.0012	29.7	Leucine Rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340467

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451998	0.708	Echinoderm microtubule-associated protein-like 5
2	9606.ENSP00000206765	0.684	Protein-glutamine gamma-glutamyltransferase K
3	9606.ENSP00000356143	0.665	Leucine rich repeat neuronal 2
4	9606.ENSP00000379241	0.661	Leucine-rich repeat-containing protein 2
5	9606.ENSP00000359925	0.656	Leucine-rich repeat-containing protein 1
6	9606.ENSP00000339467	0.628	Rho-related GTP-binding protein RhoG
7	9606.ENSP00000380517	0.618	Cadherin-24
8	9606.ENSP00000230050	0.595	Ribosomal protein S12
9	9606.ENSP00000386212	0.574	Proteasome subunit beta type-11
10	9606.ENSP00000355325	0.560	Proteasome subunit beta type-5
11	9606.ENSP00000390232	0.537	Zinc finger B-box domain containing
12	9606.ENSP00000278833	0.533	Rod outer segment membrane protein 1
13	9606.ENSP00000411816	0.525	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
14	9606.ENSP00000363482	0.502	WASH complex subunit 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0044877	0.998	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048518	0.972	positive regulation of biological process
GO:0032970	0.967	regulation of actin filament-based process
GO:0030155	0.965	regulation of cell adhesion
GO:0032956	0.962	regulation of actin cytoskeleton organization
GO:0040012	0.958	regulation of locomotion
GO:0110053	0.953	regulation of actin filament organization
GO:0051130	0.934	positive regulation of cellular component organization
GO:0045785	0.931	positive regulation of cell adhesion
GO:0044087	0.920	regulation of cellular component biogenesis
GO:0044089	0.904	positive regulation of cellular component biogenesis
GO:0010638	0.890	positive regulation of organelle organization
GO:2000145	0.875	regulation of cell motility
GO:0030334	0.872	regulation of cell migration
GO:1902743	0.869	regulation of lamellipodium organization
GO:0016043	0.858	cellular component organization
GO:1902905	0.856	positive regulation of supramolecular fiber organization
GO:0051495	0.821	positive regulation of cytoskeleton organization
GO:0031346	0.791	positive regulation of cell projection organization
GO:1902745	0.722	positive regulation of lamellipodium organization
GO:0050896	0.702	response to stimulus
GO:0010810	0.699	regulation of cell-substrate adhesion
GO:0031334	0.698	positive regulation of protein-containing complex assembly
GO:0048523	0.652	negative regulation of cellular process
GO:0032271	0.621	regulation of protein polymerization
GO:0008064	0.618	regulation of actin polymerization or depolymerization
GO:1900024	0.601	regulation of substrate adhesion-dependent cell spreading
GO:0030833	0.588	regulation of actin filament polymerization
GO:0032231	0.579	regulation of actin filament bundle assembly
GO:0030335	0.566	positive regulation of cell migration
GO:0043244	0.559	regulation of protein-containing complex disassembly
GO:0048583	0.537	regulation of response to stimulus
GO:0032233	0.481	positive regulation of actin filament bundle assembly
GO:0010811	0.478	positive regulation of cell-substrate adhesion
GO:0110020	0.475	regulation of actomyosin structure organization
GO:0051492	0.460	regulation of stress fiber assembly
GO:1900026	0.451	positive regulation of substrate adhesion-dependent cell spreading
GO:0051496	0.426	positive regulation of stress fiber assembly
GO:0051716	0.391	cellular response to stimulus
GO:0048856	0.347	anatomical structure development
GO:0007165	0.324	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0032991	0.990	protein-containing complex
GO:0043229	0.986	intracellular organelle
GO:0043228	0.962	non-membrane-bounded organelle
GO:0005829	0.943	cytosol
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0043227	0.894	membrane-bounded organelle
GO:0005856	0.708	cytoskeleton
GO:0043231	0.640	intracellular membrane-bounded organelle
GO:0015629	0.566	actin cytoskeleton
GO:0031982	0.422	vesicle
GO:0030054	0.405	cell junction
GO:0012505	0.403	endomembrane system
GO:0042995	0.366	cell projection
GO:0120025	0.317	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]