StarFunc result for job id Q8ND25

User Input

>input (227 residues)
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMD
PSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGS
RASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKD
AGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8ND25	0.999	0.999	4.959E-36	227	1.000	1.000	Q8ND25.pdb.gz	ZNRF1_HUMAN E3 ubiquitin-protein ligase ZNRF1 OS=Homo sapiens OX=9606 GN=ZNRF1 PE=1 SV=2
2	AFDB:D4A9T1	0.209	0.062	7.977E-3	987	0.233	0.054	D4A9T1.pdb.gz	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
3	AFDB:Q9VHC2	0.218	0.051	9.653E-3	1173	0.185	0.036	Q9VHC2.pdb.gz	Q9VHC2_DROME GH10160p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=4
4	AFDB:Q5EAI9	0.222	0.104	1.096E-2	494	0.220	0.101	Q5EAI9.pdb.gz	Q5EAI9_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=TEAR1 PE=1 SV=1
5	AFDB:Q6ZNA4	0.223	0.058	1.506E-2	994	0.225	0.051	Q6ZNA4.pdb.gz	RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=3
6	AFDB:Q94F54	0.212	0.105	2.205E-2	486	0.176	0.082	Q94F54.pdb.gz	Q94F54_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=TEAR2 PE=2 SV=1
7	AFDB:Q5TJ57	0.177	0.030	1.151E-1	1561	0.163	0.024	Q5TJ57.pdb.gz	FORE_DICDI Formin-E OS=Dictyostelium discoideum OX=44689 GN=forE PE=1 SV=1
8	AFDB:Q9DBU5	0.221	0.080	1.914E-1	667	0.198	0.067	Q9DBU5.pdb.gz	RNF6_MOUSE E3 ubiquitin-protein ligase RNF6 OS=Mus musculus OX=10090 GN=Rnf6 PE=1 SV=1
9	AFDB:Q15942	0.121	0.051	2.630E-1	572	0.181	0.072	Q15942.pdb.gz	ZYX_HUMAN Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1
10	AFDB:O74853	0.156	0.036	3.392E-1	1077	0.137	0.029	O74853.pdb.gz	FAP1H_SCHPO FKBP12-associated protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fap1 PE=1 SV=1
11	PDB:7mfdA	0.153	0.088	4.271E-1	410	0.044	0.024	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
12	PDB:2lgvA	0.141	0.286	4.850E-1	100	0.084	0.190	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
13	PDB:7zs96	0.233	0.149	4.850E-1	383	0.070	0.042	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
14	PDB:4a0cF	0.178	0.479	7.567E-1	80	0.062	0.175	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
15	PDB:7oniR	0.205	0.511	8.593E-1	86	0.053	0.140	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:3mhhC	0.119	0.280	1.040	93	0.035	0.086	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
17	PDB:6hlqI	0.086	0.156	1.258	111	0.053	0.108	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
18	PDB:1xa6A	0.166	0.099	1.429	399	0.057	0.033	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
19	PDB:6j6gQ	0.094	0.077	1.622	292	0.031	0.024	6j6gQ.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
20	PDB:3cxlA	0.177	0.106	1.729	402	0.040	0.022	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8ND25	4.64e-168	463	227	1.000	1.000	ZNRF1_HUMAN E3 ubiquitin-protein ligase ZNRF1 OS=Homo sapiens OX=9606 GN=ZNRF1 PE=1 SV=2
2	Q91V17	1.09e-166	460	227	0.991	0.991	ZNRF1_MOUSE E3 ubiquitin-protein ligase ZNRF1 OS=Mus musculus OX=10090 GN=Znrf1 PE=1 SV=1
3	A0A090N8Y8	1.74e-53	174	242	0.348	0.326	A0A090N8Y8_HUMAN Zinc and ring finger 2, isoform CRA_b OS=Homo sapiens OX=9606 GN=ZNRF2 PE=4 SV=1
4	Q8NHG8	1.74e-53	174	242	0.348	0.326	ZNRF2_HUMAN E3 ubiquitin-protein ligase ZNRF2 OS=Homo sapiens OX=9606 GN=ZNRF2 PE=1 SV=1
5	Q99ML9	7.65e-08	54.7	989	0.075	0.017	RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus OX=10090 GN=Rnf111 PE=1 SV=1
6	D4A9T1	8.91e-08	54.3	1011	0.075	0.017	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
7	Q6ZNA4	9.05e-08	54.3	994	0.075	0.017	RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=3
8	F1QWE1	1.24e-07	53.9	1004	0.075	0.017	F1QWE1_DANRE E3 ubiquitin-protein ligase Arkadia isoform X3 OS=Danio rerio OX=7955 GN=rnf111 PE=3 SV=2
9	N0A274	1.24e-07	53.9	1003	0.075	0.017	N0A274_DANRE E3 ubiquitin-protein ligase Arkadia isoform X4 OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
10	R4KWC4	1.25e-07	53.9	1032	0.075	0.016	R4KWC4_DANRE E3 ubiquitin-protein ligase Arkadia OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
11	Q9Y3C5	1.64e-07	51.2	154	0.093	0.136	RNF11_HUMAN RING finger protein 11 OS=Homo sapiens OX=9606 GN=RNF11 PE=1 SV=1
12	Q9QYK7	1.72e-07	51.2	154	0.093	0.136	RNF11_MOUSE RING finger protein 11 OS=Mus musculus OX=10090 GN=Rnf11 PE=1 SV=1
13	Q8SX35	2.87e-07	50.4	147	0.088	0.136	Q8SX35_DROME GEO07743p1 OS=Drosophila melanogaster OX=7227 GN=Rnf11 PE=2 SV=1
14	E9QAU8	3.58e-07	52.0	347	0.088	0.058	ARK2C_MOUSE E3 ubiquitin-protein ligase ARK2C OS=Mus musculus OX=10090 GN=Ark2c PE=1 SV=1
15	Q6ZSG1	3.74e-07	52.0	346	0.088	0.058	ARK2C_HUMAN E3 ubiquitin-protein ligase ARK2C OS=Homo sapiens OX=9606 GN=ARK2C PE=1 SV=1
16	H6TS39	6.98e-07	51.2	280	0.084	0.068	H6TS39_MAIZE Ring finger protein OS=Zea mays OX=4577 GN=RFP1 PE=2 SV=1
17	Q8GYT9	9.52e-07	50.8	358	0.128	0.081	SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana OX=3702 GN=SIS3 PE=2 SV=2
18	Q9VI20	1.22e-06	50.8	536	0.106	0.045	GZL_DROME E3 ubiquitin-protein ligase Godzilla OS=Drosophila melanogaster OX=7227 GN=gzl PE=1 SV=1
19	Q9VHC2	2.31e-06	50.1	1173	0.079	0.015	Q9VHC2_DROME GH10160p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=4
20	Q641J8	2.36e-06	50.1	622	0.088	0.032	RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis OX=8355 GN=rnf12-a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14446 Prok-RING_1	1.1e+02	14.2	Prokaryotic RING finger family 1
2	PF12230 PRP21_like_P	7.6e+02	11.3	Pre-mRNA splicing factor PRP21 like protein
3	PF15926 RNF220	4.8e+02	11.8	E3 ubiquitin-protein ligase RNF220
4	PF00097 zf-C3HC4	24	16.2	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	0.052	24.7	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	55	15.0	Zinc finger, C3HC4 type (RING finger)
7	PF05605 zf-Di19	3e+02	13.1	Drought induced 19 protein (Di19), zinc-binding
8	PF12678 zf-rbx1	18	17.0	RING-H2 zinc finger domain
9	PF08746 zf-RING-like	1.9e+02	13.6	RING-like domain
10	PF17123 zf-RING_11	0.085	23.9	RING-like zinc finger
11	PF17120 zf-RING_16	3.1	18.8	RING/Ubox like zinc-binding domain
12	PF13639 zf-RING_2	2.7e-06	38.9	Ring finger domain
13	PF14634 zf-RING_5	1.1e+02	14.2	zinc-RING finger domain
14	PF13445 zf-RING_UBOX	18	16.8	RING-type zinc-finger
15	PF18439 zf_UBZ	2.1e+02	13.0	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008582293.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008588120.1	0.982	Ubiquitin-conjugating enzyme E2 N
2	482537.XP_008579069.1	0.595	Ubiquitin-conjugating enzyme E2 D3 isoform X1
3	482537.XP_008574657.1	0.524	F-box only protein 21 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.999	protein metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0000209	0.993	protein polyubiquitination
GO:0006511	0.993	ubiquitin-dependent protein catabolic process
GO:0070936	0.961	protein K48-linked ubiquitination
GO:0071840	0.807	cellular component organization or biogenesis
GO:0065007	0.578	biological regulation
GO:0050789	0.536	regulation of biological process
GO:0016043	0.448	cellular component organization
GO:0010498	0.428	proteasomal protein catabolic process
GO:0043161	0.421	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0006996	0.386	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0012505	0.994	endomembrane system
GO:0031982	0.988	vesicle
GO:0043233	0.944	organelle lumen
GO:0070013	0.933	intracellular organelle lumen
GO:0031410	0.893	cytoplasmic vesicle
GO:0031981	0.875	nuclear lumen
GO:0005768	0.745	endosome
GO:0005654	0.466	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]