StarFunc result for job id Q8ND56

User Input

>input (463 residues)
MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDE
VFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTY
SQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQG
RSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAE
VHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFES
ANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPN
CYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGG
RGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKTTAFGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8ND56	0.999	0.999	4.751E-70	463	1.000	1.000	Q8ND56.pdb.gz	LS14A_HUMAN Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3
2	AFDB:Q9YH12	0.277	0.275	3.652E-54	467	0.795	0.788	Q9YH12.pdb.gz	LSM14_PLEWA Protein LSM14 homolog OS=Pleurodeles waltl OX=8319 GN=lsm14 PE=1 SV=1
3	AFDB:A0A8M2	0.251	0.247	2.015E-52	471	0.793	0.779	A0A8M2.pdb.gz	L14AA_XENLA Protein LSM14 homolog A-A OS=Xenopus laevis OX=8355 GN=lsm14a-a PE=1 SV=1
4	AFDB:Q68FI1	0.203	0.222	2.880E-34	422	0.508	0.557	Q68FI1.pdb.gz	L14BA_XENLA Protein LSM14 homolog B-A OS=Xenopus laevis OX=8355 GN=lsm14b-a PE=1 SV=1
5	AFDB:Q498K9	0.196	0.238	3.273E-33	380	0.492	0.600	Q498K9.pdb.gz	L14BB_XENLA Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1
6	AFDB:Q7ZVT0	0.197	0.238	2.346E-28	382	0.415	0.503	Q7ZVT0.pdb.gz
7	AFDB:M9PF20	0.160	0.119	7.322E-21	657	0.378	0.266	M9PF20.pdb.gz	M9PF20_DROME Trailer hitch, isoform H OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
8	AFDB:Q9C658	0.172	0.135	2.656E-18	611	0.365	0.277	Q9C658.pdb.gz	DCP5_ARATH Protein decapping 5 OS=Arabidopsis thaliana OX=3702 GN=DCP5 PE=1 SV=1
9	AFDB:Q9HGL3	0.183	0.197	3.188E-18	426	0.272	0.296	Q9HGL3.pdb.gz	SUM2_SCHPO Protein sum2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sum2 PE=1 SV=1
10	PDB:3jb9E	0.129	0.560	1.785E-5	98	0.043	0.204	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
11	PDB:3swnQ	0.125	0.714	3.483E-5	73	0.032	0.205	3swnQ.pdb.gz	Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
12	PDB:5vsuF	0.122	0.655	4.180E-5	77	0.026	0.156	5vsuF.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:3jcmh	0.130	0.710	6.396E-5	77	0.032	0.195	3jcmh.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
14	PDB:3jb9D	0.126	0.557	6.796E-5	96	0.028	0.135	3jb9D.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
15	PDB:6ppqG	0.135	0.645	8.155E-5	85	0.032	0.176	6ppqG.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
16	PDB:6exnr	0.137	0.724	9.786E-5	75	0.035	0.213	6exnr.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
17	PDB:6qw666	0.122	0.676	1.409E-4	72	0.022	0.139	6qw666.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:6qw663	0.119	0.567	1.497E-4	85	0.024	0.129	6qw663.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:3pgwF	0.123	0.604	1.591E-4	85	0.024	0.129	3pgwF.pdb.gz
20	AFDB:Q7JRJ1	0.067	0.054	1.820E-1	504	0.119	0.109	Q7JRJ1.pdb.gz	EAF_DROME Ell-associated factor Eaf OS=Drosophila melanogaster OX=7227 GN=Eaf PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8M2	0.0	528	471	0.687	0.675	L14AA_XENLA Protein LSM14 homolog A-A OS=Xenopus laevis OX=8355 GN=lsm14a-a PE=1 SV=1
2	Q8K2F8	0.0	749	462	0.946	0.948	LS14A_MOUSE Protein LSM14 homolog A OS=Mus musculus OX=10090 GN=Lsm14a PE=1 SV=1
3	Q8ND56	0.0	935	463	1.000	1.000	LS14A_HUMAN Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3
4	Q9YH12	0.0	565	467	0.782	0.775	LSM14_PLEWA Protein LSM14 homolog OS=Pleurodeles waltl OX=8319 GN=lsm14 PE=1 SV=1
5	Q498K9	3.20e-116	348	380	0.447	0.545	L14BB_XENLA Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1
6	Q68FI1	1.34e-114	345	422	0.460	0.505	L14BA_XENLA Protein LSM14 homolog B-A OS=Xenopus laevis OX=8355 GN=lsm14b-a PE=1 SV=1
7	Q9BX40	2.15e-107	325	385	0.434	0.522	LS14B_HUMAN Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1
8	F1Q898	7.92e-98	300	380	0.397	0.484	F1Q898_DANRE LSM family member 14B OS=Danio rerio OX=7955 GN=zgc:55673 PE=1 SV=1
9	A8E580	9.10e-97	298	380	0.397	0.484	A8E580_DANRE Zgc:55673 protein OS=Danio rerio OX=7955 GN=lsm14b PE=2 SV=1
10	Q9XW17	2.77e-38	144	340	0.151	0.206	LS14H_CAEEL Protein LSM14 homolog car-1 OS=Caenorhabditis elegans OX=6239 GN=car-1 PE=1 SV=1
11	M9PCB7	1.13e-27	118	643	0.125	0.090	M9PCB7_DROME Trailer hitch, isoform G OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
12	Q9VTZ0	1.18e-27	118	652	0.125	0.089	Q9VTZ0_DROME GH08269p OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=3
13	M9PI44	1.21e-27	118	653	0.125	0.089	M9PI44_DROME Trailer hitch, isoform F OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
14	M9PFB2	1.23e-27	118	642	0.125	0.090	M9PFB2_DROME Trailer hitch, isoform E OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
15	M9PFG3	1.39e-27	118	647	0.125	0.090	M9PFG3_DROME Trailer hitch, isoform I OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
16	M9PFF9	1.45e-27	118	646	0.125	0.090	M9PFF9_DROME Trailer hitch, isoform D OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
17	M9PF20	1.54e-27	118	657	0.125	0.088	M9PF20_DROME Trailer hitch, isoform H OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
18	M9PF14	1.55e-27	118	656	0.125	0.088	M9PF14_DROME Trailer hitch, isoform C OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
19	Q9C658	5.63e-25	110	611	0.121	0.092	DCP5_ARATH Protein decapping 5 OS=Arabidopsis thaliana OX=3702 GN=DCP5 PE=1 SV=1
20	Q9HGL3	4.77e-22	100	426	0.117	0.127	SUM2_SCHPO Protein sum2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sum2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09532 FDF	5.1e-28	109.3	FDF domain
2	PF12701 LSM14	6.7e-29	111.1	Scd6-like Sm domain
3	PF14438 SM-ATX	6e-05	34.5	Ataxin 2 SM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014270

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008992	0.998	DEAD (Asp-Glu-Ala-Asp) box helicase 6
2	61853.ENSNLEP00000005430	0.980	Eukaryotic translation initiation factor 4E nuclear import factor 1
3	61853.ENSNLEP00000014964	0.957	Y box binding protein 1
4	61853.ENSNLEP00000013414	0.918	Cytoplasmic polyadenylation element binding protein 1
5	61853.ENSNLEP00000014121	0.913	Decapping mRNA 2
6	61853.ENSNLEP00000009835	0.888	Y box binding protein 2
7	61853.ENSNLEP00000017729	0.861	Enhancer of mRNA decapping 3
8	61853.ENSNLEP00000003888	0.844	Polyadenylate-binding protein
9	61853.ENSNLEP00000005801	0.823	5'-3' exoribonuclease 1
10	61853.ENSNLEP00000014528	0.820	Polyadenylate-binding protein
11	61853.ENSNLEP00000008094	0.805	poly(A) binding protein, cytoplasmic 1-like
12	61853.ENSNLEP00000016993	0.804	Uncharacterized protein
13	61853.ENSNLEP00000022892	0.804	Belongs to the eukaryotic initiation factor 4E family.
14	61853.ENSNLEP00000015894	0.803	PAT1 homolog 1, processing body mRNA decay factor
15	61853.ENSNLEP00000008806	0.794	Decapping mRNA 1A
16	61853.ENSNLEP00000014867	0.783	LSM1 homolog, mRNA degradation associated
17	61853.ENSNLEP00000007201	0.763	Fragile X mental retardation, autosomal homolog 1
18	61853.ENSNLEP00000011792	0.763	Fragile X mental retardation, autosomal homolog 2
19	61853.ENSNLEP00000016151	0.763	Fragile X mental retardation 1
20	61853.ENSNLEP00000014920	0.753	BicC family RNA binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.989	cellular process
GO:0010468	0.988	regulation of gene expression
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0048519	0.986	negative regulation of biological process
GO:2000112	0.986	regulation of cellular macromolecule biosynthetic process
GO:0051246	0.980	regulation of protein metabolic process
GO:0034248	0.979	regulation of amide metabolic process
GO:0010608	0.975	post-transcriptional regulation of gene expression
GO:0006417	0.972	regulation of translation
GO:0010605	0.900	negative regulation of macromolecule metabolic process
GO:0051172	0.898	negative regulation of nitrogen compound metabolic process
GO:0031324	0.897	negative regulation of cellular metabolic process
GO:0010629	0.866	negative regulation of gene expression
GO:0031327	0.866	negative regulation of cellular biosynthetic process
GO:0010558	0.853	negative regulation of macromolecule biosynthetic process
GO:0051248	0.825	negative regulation of protein metabolic process
GO:0034249	0.717	negative regulation of amide metabolic process
GO:0017148	0.710	negative regulation of translation
GO:0048518	0.510	positive regulation of biological process
GO:0071840	0.491	cellular component organization or biogenesis
GO:0016043	0.392	cellular component organization
GO:0071704	0.390	organic substance metabolic process
GO:0048522	0.344	positive regulation of cellular process
GO:0044085	0.340	cellular component biogenesis
GO:0044237	0.309	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.993	protein-containing complex
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005829	0.975	cytosol
GO:1990904	0.969	ribonucleoprotein complex
GO:0005634	0.866	nucleus
GO:0036464	0.848	cytoplasmic ribonucleoprotein granule
GO:0000932	0.660	P-body
GO:0031981	0.629	nuclear lumen
GO:0005654	0.373	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]