StarFunc result for job id Q8ND76

User Input

>input (341 residues)
MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPS
DHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTI
KCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFS
AAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQI
LKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAH
KLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F3H3	0.890	0.871	4.152E-46	349	0.912	0.891	E7F3H3.pdb.gz	E7F3H3_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=1
2	AFDB:D3YUJ3	0.798	0.743	2.485E-37	367	0.716	0.665	D3YUJ3.pdb.gz	D3YUJ3_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
3	AFDB:Q9VKF0	0.761	0.643	9.435E-33	406	0.642	0.539	Q9VKF0.pdb.gz	Q9VKF0_DROME Cyclin Y, isoform A OS=Drosophila melanogaster OX=7227 GN=CycY PE=1 SV=1
4	AFDB:P34624	0.750	0.718	4.014E-30	357	0.543	0.518	P34624.pdb.gz	CCNY_CAEEL Cyclin-Y OS=Caenorhabditis elegans OX=6239 GN=cyy-1 PE=1 SV=3
5	AFDB:Q54ZC9	0.526	0.397	1.415E-16	463	0.337	0.248	Q54ZC9.pdb.gz	Q54ZC9_DICDI Cyclin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277667 PE=3 SV=1
6	AFDB:P40186	0.400	0.471	1.380E-7	285	0.144	0.172	P40186.pdb.gz	PCL7_YEAST PHO85 cyclin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL7 PE=1 SV=3
7	AFDB:Q382C9	0.422	0.663	1.450E-7	211	0.123	0.199	Q382C9.pdb.gz	Q382C9_TRYB2 Cyclin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5660 PE=3 SV=1
8	AFDB:Q75J86	0.369	0.169	2.142E-7	798	0.185	0.079	Q75J86.pdb.gz	Q75J86_DICDI Cyclin-related 2 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277391 PE=4 SV=1
9	AFDB:Q57XT7	0.343	0.171	2.023E-6	724	0.176	0.083	Q57XT7.pdb.gz	Q57XT7_TRYB2 CYC2-like cyclin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.170 PE=4 SV=1
10	AFDB:Q9FKF6	0.368	0.555	4.640E-6	219	0.123	0.192	Q9FKF6.pdb.gz	CCU43_ARATH Cyclin-U4-3 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-3 PE=1 SV=1
11	PDB:2pk9D	0.333	0.497	5.880E-4	219	0.082	0.128	2pk9D.pdb.gz
12	PDB:7b5lY	0.251	0.327	8.548E-2	253	0.067	0.091	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
13	PDB:7nj0C	0.248	0.309	1.693E-1	270	0.047	0.059	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
14	PDB:2w96A	0.258	0.345	1.960E-1	249	0.062	0.084	2w96A.pdb.gz
15	PDB:1r4wA	0.149	0.194	4.956E-1	221	0.067	0.104	1r4wA.pdb.gz	Parallel Evolutionary Pathways for Glutathione Transferases: Structure and Mechanism of the Mitochondrial Class Kappa Enzyme rGSTK1-1
16	PDB:1g3nC	0.243	0.341	5.464E-1	233	0.065	0.094	1g3nC.pdb.gz
17	PDB:1huwA	0.104	0.179	9.348E-1	166	0.082	0.169	1huwA.pdb.gz
18	PDB:7cclC	0.111	0.182	1.136	147	0.053	0.122	7cclC.pdb.gz
19	PDB:7kw7F	0.112	0.134	1.193	259	0.100	0.131	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
20	PDB:5xtcs	0.145	0.150	1.316	318	0.097	0.104	5xtcs.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286Y7Z8	0.0	645	342	0.912	0.909	A0A286Y7Z8_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=2
2	E7F3H3	0.0	638	349	0.912	0.891	E7F3H3_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=1
3	Q8BGU5	0.0	693	341	0.982	0.982	CCNY_MOUSE Cyclin-Y OS=Mus musculus OX=10090 GN=Ccny PE=1 SV=1
4	Q8ND76	0.0	703	341	1.000	1.000	CCNY_HUMAN Cyclin-Y OS=Homo sapiens OX=9606 GN=CCNY PE=1 SV=2
5	Q8N7R7	1.22e-172	485	359	0.751	0.713	CCYL1_HUMAN Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1 PE=1 SV=2
6	D3YUJ3	1.86e-171	483	367	0.707	0.657	D3YUJ3_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
7	E9Q226	2.77e-166	466	291	0.680	0.797	E9Q226_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
8	Q9VKF0	3.78e-136	394	406	0.610	0.512	Q9VKF0_DROME Cyclin Y, isoform A OS=Drosophila melanogaster OX=7227 GN=CycY PE=1 SV=1
9	P34624	6.77e-120	351	357	0.563	0.538	CCNY_CAEEL Cyclin-Y OS=Caenorhabditis elegans OX=6239 GN=cyy-1 PE=1 SV=3
10	Q54ZC9	6.55e-59	198	463	0.284	0.210	Q54ZC9_DICDI Cyclin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277667 PE=3 SV=1
11	A0A087WPI4	6.17e-42	142	85	0.199	0.800	A0A087WPI4_MOUSE Cyclin Y-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
12	Q75J86	8.25e-09	59.3	798	0.094	0.040	Q75J86_DICDI Cyclin-related 2 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277391 PE=4 SV=1
13	Q9FKF6	1.35e-07	53.9	219	0.126	0.196	CCU43_ARATH Cyclin-U4-3 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-3 PE=1 SV=1
14	O80513	4.92e-06	48.9	202	0.091	0.153	CCU41_ARATH Cyclin-U4-1 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-1 PE=1 SV=1
15	Q7K6A7	3.35e-05	47.0	229	0.079	0.118	Q7K6A7_PLAF7 Cyclin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518400 PE=3 SV=1
16	P24867	0.001	42.4	279	0.111	0.136	PCL1_YEAST PHO85 cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL1 PE=1 SV=1
17	F4K6B8	0.016	39.7	1090	0.079	0.025	RGI4_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4 OS=Arabidopsis thaliana OX=3702 GN=RGI4 PE=1 SV=1
18	A0A1D8PNP1	0.065	37.4	373	0.073	0.067	A0A1D8PNP1_CANAL Pcl1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PCL1 PE=4 SV=1
19	Q382C9	0.16	35.4	211	0.079	0.128	Q382C9_TRYB2 Cyclin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5660 PE=3 SV=1
20	Q9NG22	0.16	35.4	211	0.079	0.128	Q9NG22_9TRYP Cyclin OS=Trypanosoma brucei OX=5691 GN=CYC2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08613 Cyclin	3.1e-08	45.6	Cyclin
2	PF00134 Cyclin_N	4.4e-11	54.0	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000007557

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000009818	0.892	Cyclin-dependent kinase 16
2	60711.ENSCSAP00000008686	0.874	Cyclin-dependent kinase 14
3	60711.ENSCSAP00000014209	0.655	Eukaryotic translation initiation factor 4H
4	60711.ENSCSAP00000005728	0.632	Sideroflexin 1
5	60711.ENSCSAP00000006759	0.614	Cyclin-dependent kinase 15
6	60711.ENSCSAP00000018369	0.598	Transmembrane protein 186
7	60711.ENSCSAP00000010760	0.583	Cyclin-dependent kinase 18
8	60711.ENSCSAP00000014478	0.548	Cyclin-dependent kinase 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0016538	0.672	cyclin-dependent protein serine/threonine kinase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.956	regulation of cellular process
GO:0009987	0.927	cellular process
GO:0050896	0.916	response to stimulus
GO:0031323	0.866	regulation of cellular metabolic process
GO:0060255	0.815	regulation of macromolecule metabolic process
GO:0080090	0.802	regulation of primary metabolic process
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0051338	0.642	regulation of transferase activity
GO:0031399	0.616	regulation of protein modification process
GO:0009620	0.615	response to fungus
GO:0048518	0.609	positive regulation of biological process
GO:0001878	0.598	response to yeast
GO:0051726	0.564	regulation of cell cycle
GO:0045859	0.552	regulation of protein kinase activity
GO:0071900	0.477	regulation of protein serine/threonine kinase activity
GO:0048522	0.450	positive regulation of cellular process
GO:0009893	0.429	positive regulation of metabolic process
GO:0031325	0.367	positive regulation of cellular metabolic process
GO:1904029	0.367	regulation of cyclin-dependent protein kinase activity
GO:0000079	0.358	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0007049	0.322	cell cycle
GO:0022402	0.310	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0000307	1.000	cyclin-dependent protein kinase holoenzyme complex
GO:0043227	0.986	membrane-bounded organelle
GO:0005737	0.976	cytoplasm
GO:0005634	0.976	nucleus
GO:0016020	0.952	membrane
GO:0071944	0.875	cell periphery
GO:0005886	0.851	plasma membrane
GO:0005829	0.572	cytosol
GO:0031981	0.508	nuclear lumen
GO:0005654	0.426	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]