StarFunc result for job id Q8ND83

User Input

>input (568 residues)
MMAEQVKCASAGVSSGAGSGPVVNAELEVKKLQELVRKLEKQNEQLRSRAASAAAAPHLL
LLPPPPPAAPPPAGLQPLGPRSPPAATATAAASGGLGPAFPGTFCLPSPAPSLLCSLAQP
PEAPFVYFKPAAGFFGAGGGGPEPGGAGTPPGAAAAPPSPPPTLLDEVELLDLESVAAWR
DEDDYTWLYIGSSKTFTSSEKSLTPLQWCRHVLDNPTPEMEAARRSLCFRLEQGYTSRGS
PLSPQSSIDSELSTSELEDDSISMGYKLQDLTDVQIMARLQEESLRQDYASTSASVSRHS
SSVSLSSGKKGTCSDQEYDQYSLEDEEEFDHLPPPQPRLPRCSPFQRGIPHSQTFSSIRE
CRRSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSTTAISSNI
SSPVTVRNSQSFDSSLHGAGNGISRIQSCIPSPGQLQHRVHSVGHFPVSIRQPLKATAYV
SPTVQGSSNMPLSNGLQLYSNTGIPTPNKAAASGIMGRSALPRPSLAINGSNLPRSKIAQ
PVRSFLQPPKPLSSLSTLRDGNWRDGCY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8ND83	0.999	0.999	5.078E-86	568	1.000	1.000	Q8ND83.pdb.gz	SLAI1_HUMAN SLAIN motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SLAIN1 PE=1 SV=3
2	AFDB:O08789	0.066	0.064	7.542E-6	591	0.201	0.193	O08789.pdb.gz	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
3	AFDB:O94972	0.074	0.046	1.163E-4	964	0.132	0.078	O94972.pdb.gz	TRI37_HUMAN E3 ubiquitin-protein ligase TRIM37 OS=Homo sapiens OX=9606 GN=TRIM37 PE=1 SV=2
4	AFDB:H7C179	0.075	0.051	3.031E-4	861	0.173	0.114	H7C179.pdb.gz	H7C179_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
5	AFDB:Q14126	0.062	0.040	8.455E-4	1118	0.143	0.072	Q14126.pdb.gz	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
6	AFDB:Q03213	0.046	0.037	3.320E-3	719	0.150	0.118	Q03213.pdb.gz	HOT1_YEAST High-osmolarity-induced transcription protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOT1 PE=1 SV=1
7	AFDB:A0A1D8PTQ2	0.064	0.043	8.079E-3	907	0.148	0.093	A0A1D8PTQ2.pdb.gz	A0A1D8PTQ2_CANAL Decapping enzyme complex catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCP2 PE=3 SV=1
8	AFDB:A0A1D8PMD1	0.052	0.051	8.650E-3	659	0.160	0.138	A0A1D8PMD1.pdb.gz	A0A1D8PMD1_CANAL Phosphate-sensing transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO4 PE=4 SV=1
9	AFDB:Q585K3	0.057	0.055	1.218E-2	601	0.164	0.155	Q585K3.pdb.gz	Q585K3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.220 PE=4 SV=1
10	AFDB:A1Z6W3	0.072	0.041	1.396E-2	1299	0.155	0.068	A1Z6W3.pdb.gz	PRIC1_DROME Protein prickle OS=Drosophila melanogaster OX=7227 GN=pk PE=1 SV=1
11	PDB:4cguA	0.044	0.191	2.786	112	0.026	0.134	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
12	PDB:6ff4C	0.043	0.076	3.663	286	0.037	0.073	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
13	PDB:4cz2B	0.054	0.124	4.200	179	0.016	0.050	4cz2B.pdb.gz	Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
14	PDB:5mrcQ	0.038	0.070	6.778	284	0.016	0.032	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
15	PDB:7d5s5J	0.043	0.144	7.258	151	0.030	0.113	7d5s5J.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:7vkkA	0.068	0.124	7.258	287	0.023	0.045	7vkkA.pdb.gz
17	PDB:5nrlG	0.064	0.086	7.772	372	0.042	0.065	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
18	PDB:6iczM	0.048	0.133	8.911	130	0.023	0.100	6iczM.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
19	PDB:6o9lQ	0.034	0.043	8.911	430	0.042	0.056	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8ND83	0.0	1145	568	1.000	1.000	SLAI1_HUMAN SLAIN motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SLAIN1 PE=1 SV=3
2	A0A024R9T6	5.98e-66	227	581	0.398	0.389	A0A024R9T6_HUMAN HCG17415, isoform CRA_a OS=Homo sapiens OX=9606 GN=SLAIN2 PE=2 SV=1
3	Q9P270	5.98e-66	227	581	0.398	0.389	SLAI2_HUMAN SLAIN motif-containing protein 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=2
4	Q8CI08	4.77e-42	161	581	0.264	0.258	SLAI2_MOUSE SLAIN motif-containing protein 2 OS=Mus musculus OX=10090 GN=Slain2 PE=1 SV=2
5	D6RIF6	2.63e-40	153	414	0.264	0.362	D6RIF6_HUMAN SLAIN motif family member 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=1
6	Q54T88	0.19	37.4	1746	0.040	0.013	Q54T88_DICDI Cell fusion related protein OS=Dictyostelium discoideum OX=44689 GN=mrhA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	2.4e+02	13.3	bZIP transcription factor
2	PF15301 SLAIN	1.6e-138	474.5	SLAIN motif-containing family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448051	0.770	DAZ associated protein 2
2	9606.ENSP00000331305	0.768	Protein Tob2
3	9606.ENSP00000432768	0.624	Cytoskeleton-associated protein 5
4	9606.ENSP00000366416	0.588	Endothelin receptor type B
5	9606.ENSP00000452885	0.583	Ubiquitin carboxyl-terminal hydrolase MINDY-2
6	9606.ENSP00000403397	0.541	Palmitoyltransferase ZDHHC17
7	9606.ENSP00000297792	0.505	Lysine-specific histone demethylase 1B
8	9606.ENSP00000426354	0.505	Transmembrane protein 161B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0000226	0.992	microtubule cytoskeleton organization
GO:0031113	0.968	regulation of microtubule polymerization
GO:0097435	0.935	supramolecular fiber organization
GO:0031122	0.868	cytoplasmic microtubule organization
GO:0048518	0.701	positive regulation of biological process
GO:0048522	0.675	positive regulation of cellular process
GO:0051130	0.456	positive regulation of cellular component organization
GO:0022607	0.430	cellular component assembly
GO:0044089	0.356	positive regulation of cellular component biogenesis
GO:0010638	0.339	positive regulation of organelle organization
GO:0051258	0.331	protein polymerization
GO:0051495	0.311	positive regulation of cytoskeleton organization
GO:0046785	0.300	microtubule polymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0005829	0.999	cytosol
GO:0099080	0.924	supramolecular complex
GO:0043231	0.880	intracellular membrane-bounded organelle
GO:0005634	0.826	nucleus
GO:0099512	0.592	supramolecular fiber
GO:0099513	0.558	polymeric cytoskeletal fiber
GO:1990752	0.549	microtubule end
GO:0035371	0.447	microtubule plus-end
GO:0016020	0.396	membrane
GO:0070013	0.337	intracellular organelle lumen
GO:0031981	0.328	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]