StarFunc result for job id Q8NDA2

User Input

>input (1400 residues)
MPGAPLLRLLTAVSAAVAVAVAGAPGTVMPPTTGDATLAFVFDVTGSMWDELMQVIDGAS
RILERSLSRRSQAIANYALVPFHDPDIGPVTLTADPTVFQRELRELYVQGGGDCPEMSVG
AIKAAVEVANPGSFIYVFSDARAKDYHKKEELLRLLQLKQSQVVFVLTGDCGDRTHPGYL
AYEEIAATSSGQVFHLDKQQVTEVLKWVESAIQASKVHLLSTDHEEEGEHTWRLPFDPSL
KEVTISLSGPGPEIEVQDPLGRILQEDEGLNVLLNIPDSAKVVAFKPEHPGLWSIKVYSS
GRHSVRITGVSNIDFRAGFSTQPLLDLNHTLEWPLQGVPISLVINSTGLKAPGRLDSVEL
AQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHEGNPLLRVSGVSYS
GVAPGAPLVSMAPRIHGYLHQPLLVSCSVHSALPFRLQLRRGEARLGEERHFQESGNSSW
EILRASKAEEGTYECTAVSRAGTGRAKAQIVVTDPPPQLVPAPNVTVSPGETAVLSCRVL
GEAPYNLTWVRDWRVLPASTGRVAQLADLSLEISGIIPTDGGRYQCVASNANGVTRASVW
LLVREAPQVSIHTSSQHFSQGVEVKVSCSASGYPTPHISWSRESQALQEDSRIHVDAQGT
LIIQGVAPEDAGNYSCQATNEVGTDQETVTLYYTDPPSVSAVNAVVLVAVGEEAVLVCEA
SGVPPPRVIWYRGGLEMILAPEGSSSGKLRIPAAQERDAGTYTCRAVNELGDASAEIQLA
VGHAPQLTELPRDVTVELGRSALLACRATGRPPPTVTWRRGDGQPLGLRLGAGRGSRSRQ
PDSGVLFFESVAPEDQAPYVCEARNVFGKVQAEARLIVTGHAPPQIASSAPTVRVLEGQP
VSLPCIVLAGRPLPERHWLKDGRPLPPGSRHSIRADGSLHLDRALQEHAGRYSCVATNTA
GSQHRDVELVVQVPPRIHPTATHHITNEGVAASLPCVASGVPAPTITWTKETNALTSRGP
HYNVSKEGTLLIAQPSAQDAGAYVCTATNTVGFSSQEMRLSVNTKPRIHMNGSRNADVPL
QVTAKAGEEVTLDCEAKGSPPPLVTWTKDSRPVPPITNRYGLLPSGSLRLAQVQVGDSGH
YECTASNPAGSASHRYVLGVQVPPQVQPGPRVLKVLVGEALDLNCVAEGNPEPQLSWSKD
GVVLQGRGPQGSVHFAAIRTSDAGRYRCEASNSAGVDAWEVELRVLEPPHWGADETSGLL
ERVAGENASLPCPARGTPKPQVTWRKGPSSEPLHGQPGVAVLEEGSLFLASVSPADSGDY
ECQATNEVGSTSRRAKLVVYVPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLK
DAQLIPKVGGHRLLDEGQSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EY71	0.219	0.379	6.220E-92	783	0.298	0.533	E7EY71.pdb.gz
2	AFDB:Q3V1M1	0.138	0.099	5.530E-68	2594	0.181	0.098	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
3	AFDB:Q6WRH9	0.146	0.091	6.487E-65	2597	0.186	0.101	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
4	AFDB:Q6WRI0	0.133	0.085	7.458E-65	2623	0.179	0.095	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
5	AFDB:E7F5U2	0.128	0.077	1.427E-62	2497	0.166	0.093	E7F5U2.pdb.gz
6	AFDB:F1NY98	0.253	0.185	8.085E-53	2034	0.165	0.114	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
7	AFDB:Q4VA61	0.257	0.185	8.873E-53	2053	0.169	0.115	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
8	AFDB:Q9NEG0	0.119	0.180	1.698E-50	907	0.145	0.224	Q9NEG0.pdb.gz	Q9NEG0_DROME EG:BACR25B3.10 protein OS=Drosophila melanogaster OX=7227 GN=trol PE=4 SV=1
9	AFDB:Q9VS29	0.121	0.086	1.441E-49	2074	0.189	0.128	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3
10	AFDB:A0A2R8QL08	0.124	0.097	2.763E-49	2036	0.174	0.119	A0A2R8QL08.pdb.gz
11	PDB:5oj2B	0.130	0.234	2.464E-30	692	0.118	0.238	5oj2B.pdb.gz
12	PDB:1e07A	0.170	0.322	2.079E-23	642	0.094	0.206	1e07A.pdb.gz
13	PDB:7sqcO0	0.111	0.128	3.211E-16	1140	0.090	0.111	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:6dldD	0.100	0.380	1.027E-15	269	0.052	0.271	6dldD.pdb.gz
15	PDB:5a42A	0.101	0.092	1.357E-15	1597	0.084	0.073	5a42A.pdb.gz
16	PDB:4ziqA	0.122	0.119	5.864E-14	1450	0.088	0.085	4ziqA.pdb.gz
17	PDB:6dlfA	0.097	0.414	6.143E-14	236	0.051	0.301	6dlfA.pdb.gz
18	PDB:7q5zA	0.137	0.141	9.545E-13	1344	0.070	0.073	7q5zA.pdb.gz
19	PDB:6h03A	0.146	0.160	9.999E-13	1223	0.064	0.074	6h03A.pdb.gz
20	PDB:7q1yA	0.137	0.138	1.451E-12	1374	0.066	0.067	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AJ76	0.0	2333	5100	0.829	0.228	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
2	D3YXG0	0.0	1241	5634	0.454	0.113	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
3	E7F3V2	0.0	1303	4212	0.486	0.161	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
4	G5ED27	0.0	709	5175	0.305	0.083	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
5	G5EDG4	0.0	709	3962	0.305	0.108	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
6	G5EG33	0.0	709	5198	0.305	0.082	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
7	Q8NDA2	0.0	2828	5059	1.000	0.277	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
8	Q96RW7	0.0	1234	5635	0.455	0.113	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
9	A2ASS6	3.01e-84	308	35213	0.180	0.007	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
10	Q6WRI0	3.91e-84	307	2623	0.184	0.098	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
11	A0A8I5ZUN3	1.13e-82	303	35375	0.174	0.007	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
12	Q6WRH9	6.97e-82	300	2597	0.194	0.104	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
13	Q3V1M1	5.26e-79	291	2594	0.186	0.100	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
14	Q8WZ42	1.06e-77	288	34350	0.174	0.007	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
15	Q9NR99	2.54e-77	286	2828	0.188	0.093	MXRA5_HUMAN Matrix-remodeling-associated protein 5 OS=Homo sapiens OX=9606 GN=MXRA5 PE=1 SV=3
16	Q7TN00	5.50e-76	282	3410	0.196	0.080	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
17	P98160	1.63e-72	271	4391	0.198	0.063	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
18	A0A8I6A2S5	1.32e-67	255	4402	0.194	0.062	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
19	A0A8I6ASH2	1.99e-67	254	4387	0.194	0.062	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
20	Q05793	2.65e-65	248	3707	0.189	0.071	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05790 C2-set	0.086	24.4	Immunoglobulin C2-set domain
2	PF08205 C2-set_2	1.9e-24	96.8	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	1.4e-153	510.7	Immunoglobulin I-set domain
4	PF00047 ig	1.6e-92	315.1	Immunoglobulin domain
5	PF13895 Ig_2	3.5e-111	375.0	Immunoglobulin domain
6	PF13927 Ig_3	1.4e-149	498.3	Immunoglobulin domain
7	PF16680 Ig_4	1.8e-08	46.2	T-cell surface glycoprotein CD3 delta chain
8	PF16681 Ig_5	1.1e-10	53.2	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
9	PF18452 Ig_6	0.00015	33.0	Immunoglobulin domain
10	PF17736 Ig_C17orf99	3.8e-12	57.4	C17orf99 Ig domain
11	PF16706 Izumo-Ig	6.3e-06	37.3	Izumo-like Immunoglobulin domain
12	PF07686 V-set	2.5e-52	187.0	Immunoglobulin V-set domain
13	PF08204 V-set_CD47	0.02	26.3	CD47 immunoglobulin-like domain
14	PF13519 VWA_2	22	17.1	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485357

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329287	0.741	Stannin
2	9606.ENSP00000215917	0.703	SRR1-like protein
3	9606.ENSP00000326330	0.653	Fraser extracellular matrix complex subunit 1
4	9606.ENSP00000299633	0.601	Hepatoma-derived growth factor-related protein 3
5	9606.ENSP00000265627	0.594	Serum paraoxonase/lactonase 3
6	9606.ENSP00000386665	0.586	Four and a half LIM domains protein 2
7	9606.ENSP00000280481	0.580	FRAS1-related extracellular matrix protein 2
8	9606.ENSP00000440703	0.556	Nuclear pore complex interacting protein family member B5
9	9606.ENSP00000348033	0.539	Olfactory receptor 11L1
10	9606.ENSP00000305640	0.529	Olfactory receptor 6F1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.421	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.959	cellular process
GO:0045229	0.849	external encapsulating structure organization
GO:0043062	0.595	extracellular structure organization
GO:0030198	0.589	extracellular matrix organization
GO:0032501	0.524	multicellular organismal process
GO:0032502	0.450	developmental process
GO:0048856	0.440	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0071944	0.994	cell periphery
GO:0062023	0.975	collagen-containing extracellular matrix
GO:0005622	0.404	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]