StarFunc result for job id Q8NDA8

User Input

>input (1641 residues)
MTESSMKKLASTLLDAITDKDPLVQEQVCSALCSLGEARPVETLRACEEYLRQHDKLAHP
YRAAVLRAMERVLSSRASELDKDTASTIILLASSEMTKTKDLVWDWQQAASGVLVAVGRQ
FISKVMEELLRRLHPGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDT
VRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLR
LAVVEALGPMSHLLPSERLEEQLPKLLPGILALYKKHAETFYLSKSLGQILEAAVSVGSR
TLETQLDALLAALHSQICVPVESSSPLVMSNQKEVLRCFTVLACSSPDRLLAFLLPRLDT
SNERTRVGTLQVVRHVINSAAAQMEDKKPFILSSMRLPLLDTNSKVKRAVVQVISAMAHH
GYLEQPGGEAMIEYIVQQCALPPEQEPEKPGPGSKDPKADSVRAISVRTLYLVSTTVDRM
SHVLWPYLLQFLTPVRFTGALTPLCRSLVHLAQKRQEAGADAFLIQYDAHASLPSPYAVT
GRLLVVSSSPYLGDGRGAAALRLLSVLHPNIHPLLGQHWETTVPLLLGYLDEHTEETLPQ
EEWEEKLLMFLRDTLAIISDNAWICQLSLELCRQLPCYDEAPQEKNFLYKCIGTTLGAAS
SKEVVRKHLQELLETARYQEEAEREGLACCFGICAISHLEDTLAQLEDFVRSEVFRKSIG
ILNIFKDRSENEVEKVKSALILCYGHVAARAPRELVLAKVESDILRNICQHFSTKVLGIK
VETKDPALKLCLVQSVCMVSRAICSSTQAGSFHFTRKAELVAQMMEFIRAEPPDSLRTPI
RKKAMLTCTYLVSVEPALDEQARADVIHGCLHSIMALLPEPKEEDGGCQKSLYLETLHAL
EDLLTSLLQRNMTPQGLQIMIEHLSPWIKSPRGHERARALGLSALLLRYFLEHLRVSALV
PFHNLGLLIGLFSPRCADLWPATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLLSLK
DGLVHPDPAILFHTCHSVGQIIAKRLPPDQLISLLLTMFEALGDPEKNCSRAATVMINCL
LQERGGVLQEKVPEIVSVLRSKLQEAQGEHVLPAAQHSVYLLATQHCAAVVSSLLGSPLP
LDSHTCMLWRALAVEPRLAAQVLGLLLEKMSRDVPFKESRAFLLGRTPDRVATLLPLSAT
CALFEVMSTPAAGPAVLELYPQLFVVLLLRVSCTVGVQLPRNLQAQERRGASPALATRNL
EPCSSAVDTLRSMLLRSGSEDVVQRMDLEGGWELLRTSAGHEEGATRLARAMAEHAGPRL
PLVLKTLACTHSSAYENQRVTTTAFLAELLNSNVANDLMLLDSLLESLAARQKDTCASVR
RLVLRGLANLASGCPDKVRTHGPQLLTAMIGGLDDGDNPHSPVALEAMLGLARLVHLVES
WDLRSGLLHVAIRIRPFFDSEKMEFRTASIRLFGHLNKVCHGDCEDVFLDQVVGGLAPLL
LHLQDPQATVASACRFALRMCGPNLACEELSAAFQKHLQEGRALHFGEFLNTTCKHLMHH
FPDLLGRLLTTCLFYFKSSWENVRAAAPLFTGFLVLHSEPRQQPQVDLDQLIAALQILLK
DPAPEVRTRAAEALGRLVKLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q54F23	0.765	0.763	1.044E-74	1647	0.262	0.261	Q54F23.pdb.gz	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
2	AFDB:Q7M6Y6	0.401	0.414	1.756E-59	1581	0.270	0.280	Q7M6Y6.pdb.gz	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
3	AFDB:Q9W350	0.527	0.506	3.289E-56	1742	0.234	0.220	Q9W350.pdb.gz	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
4	AFDB:F4IP13	0.655	0.632	2.441E-51	1716	0.224	0.214	F4IP13.pdb.gz	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
5	AFDB:Q68CQ1	0.227	0.268	8.106E-27	1323	0.138	0.172	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
6	AFDB:G3X8W1	0.287	0.406	1.479E-26	983	0.137	0.228	G3X8W1.pdb.gz	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
7	AFDB:E9PVA8	0.169	0.120	3.227E-15	2671	0.137	0.084	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
8	AFDB:F4I893	0.166	0.115	1.195E-14	2696	0.145	0.088	F4I893.pdb.gz	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
9	AFDB:Q9HDV6	0.283	0.224	1.702E-14	2196	0.138	0.103	Q9HDV6.pdb.gz	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
10	AFDB:P33892	0.135	0.100	3.840E-14	2672	0.148	0.091	P33892.pdb.gz	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
11	PDB:7mp6B	0.210	0.213	5.369E-13	1609	0.128	0.131	7mp6B.pdb.gz
12	PDB:7r04B	0.224	0.176	9.101E-12	2229	0.145	0.107	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
13	PDB:7pgsN	0.240	0.224	2.127E-11	1787	0.149	0.137	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
14	PDB:6yejA	0.144	0.122	7.876E-11	2046	0.160	0.129	6yejA.pdb.gz
15	PDB:4a0cA	0.197	0.249	1.339E-10	1155	0.108	0.154	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
16	PDB:7mqaLM	0.174	0.150	1.542E-10	2041	0.141	0.114	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mp5A	0.208	0.209	3.605E-10	1629	0.140	0.141	7mp5A.pdb.gz
18	PDB:7mqaSP	0.145	0.110	6.816E-10	2485	0.164	0.108	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7r03B	0.226	0.175	1.383E-9	2246	0.154	0.113	7r03B.pdb.gz
20	PDB:7pgrN	0.216	0.161	1.484E-9	2423	0.164	0.111	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q54F23	0.0	679	1647	0.277	0.276	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
2	Q7M6Y6	6.70e-180	585	1581	0.278	0.288	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
3	Q9W350	8.28e-107	379	1742	0.257	0.242	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
4	F4IP13	1.56e-80	297	1716	0.152	0.145	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
5	Q9NHY0	9.11e-75	277	1407	0.194	0.227	Q9NHY0_DROME C11.1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=4 SV=1
6	Q68CQ1	5.42e-54	210	1323	0.142	0.176	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
7	G3X8W1	7.59e-40	164	983	0.122	0.203	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
8	Q14DS2	7.63e-40	163	914	0.122	0.219	Q14DS2_MOUSE 1700016M24Rik protein OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
9	E9PZ22	9.32e-40	163	914	0.122	0.219	E9PZ22_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
10	Q9DA96	1.28e-39	163	983	0.122	0.203	Q9DA96_MOUSE Maestro heat-like repeat family member 5 OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
11	A0A5F8MPT5	2.65e-26	115	385	0.061	0.260	A0A5F8MPT5_MOUSE Maestro heat-like repeat family member 4 (Fragment) OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
12	Q7TNB4	2.35e-14	77.0	248	0.037	0.242	MSTRO_MOUSE Protein maestro OS=Mus musculus OX=10090 GN=Mro PE=2 SV=1
13	Q9SL79	5.5	34.3	701	0.020	0.046	CAF1P_ARATH CRS2-associated factor 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g20020 PE=2 SV=2
14	Q5W041	7.3	33.9	872	0.013	0.024	ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=ARMC3 PE=2 SV=2
15	Q10105	10.0	33.5	2670	0.013	0.008	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	1.9e+02	13.6	Armadillo/beta-catenin-like repeat
2	PF00214 Calc_CGRP_IAPP	3.9e+02	13.0	Calcitonin / CGRP / IAPP family
3	PF12717 Cnd1	0.00022	32.8	non-SMC mitotic condensation complex subunit 1
4	PF20416 DUF6700	3.7e+02	12.0	Domain of unknown function (DUF6700)
5	PF02985 HEAT	9.6e-08	42.7	HEAT repeat
6	PF13646 HEAT_2	5.5e-08	44.4	HEAT repeats
7	PF13513 HEAT_EZ	8.4e-05	34.3	HEAT-like repeat
8	PF20168 PDS5	13	15.1	Sister chromatid cohesion protein PDS5 protein
9	PF10363 RTP1_C1	24	16.5	Required for nuclear transport of RNA pol II C-terminus 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000435565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320648	0.831	WD repeat-containing protein 97
2	9606.ENSP00000292539	0.722	Protein phosphatase 1 regulatory subunit 16A
3	9606.ENSP00000387426	0.698	Cysteine and histidine rich 1
4	9606.ENSP00000415436	0.686	KAT8 regulatory NSL complex subunit 2
5	9606.ENSP00000454468	0.671	Transmembrane protein 249
6	9606.ENSP00000366522	0.633	Rho GTPase activating protein 39
7	9606.ENSP00000310547	0.627	Uncharacterized aarF domain-containing protein kinase 5
8	9606.ENSP00000480053	0.608	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
9	9606.ENSP00000484669	0.594	Cleavage and polyadenylation specificity factor subunit 1
10	9606.ENSP00000347206	0.576	Glycosylphosphatidylinositol anchor attachment 1 protein
11	9606.ENSP00000330098	0.570	F-box/LRR-repeat protein 6
12	9606.ENSP00000341528	0.569	Zinc finger protein 34
13	9606.ENSP00000314380	0.567	Protein lifeguard 1
14	9606.ENSP00000329565	0.561	Speedy protein E3
15	9606.ENSP00000321320	0.544	Protein HGH1 homolog
16	9606.ENSP00000359222	0.544	Transmembrane protein 56
17	9606.ENSP00000337501	0.529	Nuclear receptor-interacting protein 2
18	9606.ENSP00000394751	0.529	Interactor protein for cytohesin exchange factors 1
19	9606.ENSP00000373565	0.506	Protein FAM83H
20	9606.ENSP00000351631	0.502	Protein FAM76B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.692	biological regulation
GO:0050789	0.558	regulation of biological process
GO:0050794	0.547	regulation of cellular process
GO:0071840	0.489	cellular component organization or biogenesis
GO:0016043	0.431	cellular component organization
GO:0008152	0.399	metabolic process
GO:0050896	0.395	response to stimulus
GO:0071704	0.324	organic substance metabolic process
GO:0051179	0.303	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.975	endomembrane system
GO:0016020	0.843	membrane
GO:0005634	0.830	nucleus
GO:0043233	0.810	organelle lumen
GO:0070013	0.798	intracellular organelle lumen
GO:0031981	0.585	nuclear lumen
GO:0005654	0.582	nucleoplasm
GO:0005829	0.537	cytosol
GO:0031982	0.410	vesicle
GO:0043232	0.304	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]