StarFunc result for job id Q8NDB2

User Input

>input (785 residues)
MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLY
RLENFSFRHLELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKS
SDQLYELLNISQSRWEISTEQEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISE
RKEIEELSEASRNTIPLAVVLPTEIPCENPGEIFIILRDEVIGDTVEVEFTSSNKRIRTR
PALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLC
QNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCAAKFGLKNLAI
HLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESS
EDQYDDLYVFIPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQME
RSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKK
TGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRAR
IESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEKFKHWQMGKSGLEMIQQEKLR
QLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPARPQVEKEFGFC
CKKDH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NDB2	1.000	1.000	0.000	785	1.000	1.000	Q8NDB2.pdb.gz	BANK1_HUMAN B-cell scaffold protein with ankyrin repeats OS=Homo sapiens OX=9606 GN=BANK1 PE=1 SV=3
2	AFDB:Q80VH0	0.402	0.403	5.543E-92	783	0.664	0.665	Q80VH0.pdb.gz	BANK1_MOUSE B-cell scaffold protein with ankyrin repeats OS=Mus musculus OX=10090 GN=Bank1 PE=1 SV=3
3	AFDB:F1NBU2	0.205	0.218	1.546E-60	730	0.371	0.399	F1NBU2.pdb.gz
4	AFDB:Q9VFI0	0.153	0.103	8.490E-27	1220	0.163	0.105	Q9VFI0.pdb.gz	Q9VFI0_DROME Stumps, isoform E OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=3
5	PDB:6xi2A	0.101	0.144	4.903E-4	528	0.039	0.059	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.
6	PDB:1xb2A	0.135	0.249	8.938E-4	369	0.051	0.108	1xb2A.pdb.gz
7	PDB:7anwA	0.135	0.161	1.136E-3	645	0.036	0.043	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
8	AFDB:P28006	0.072	0.071	1.448E-3	793	0.103	0.102	P28006.pdb.gz	GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2
9	PDB:1sulB	0.134	0.440	5.748E-3	195	0.025	0.103	1sulB.pdb.gz
10	PDB:1i3cA	0.108	0.407	6.104E-3	144	0.038	0.208	1i3cA.pdb.gz
11	PDB:3breB	0.127	0.270	7.309E-3	328	0.015	0.037	3breB.pdb.gz	Phosphorylation-independent regulation of the diguanylate cyclase WspR.
12	PDB:3esxB	0.100	0.334	8.241E-3	169	0.022	0.101	3esxB.pdb.gz	Flavodoxin: A compromise between efficiency and versatility in the electron transfer from Photosystem I to Ferredoxin-NADP(+) reductase
13	PDB:6vxkB	0.101	0.105	8.751E-3	747	0.009	0.009	6vxkB.pdb.gz
14	PDB:5ghuA	0.070	0.211	9.867E-3	201	0.017	0.065	5ghuA.pdb.gz
15	PDB:7cm7A	0.126	0.157	9.867E-3	620	0.031	0.039	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
16	AFDB:Q91V27	0.057	0.068	1.115E-2	590	0.076	0.102	Q91V27.pdb.gz	MELPH_MOUSE Melanophilin OS=Mus musculus OX=10090 GN=Mlph PE=1 SV=1
17	AFDB:Q8SWR8	0.053	0.041	2.434E-2	1084	0.112	0.081	Q8SWR8.pdb.gz	ATX2_DROME Ataxin-2 homolog OS=Drosophila melanogaster OX=7227 GN=Atx2 PE=1 SV=1
18	AFDB:Q5TYW2	0.086	0.082	2.585E-2	823	0.057	0.055	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
19	AFDB:Q5RH27	0.050	0.044	2.745E-2	898	0.094	0.082	Q5RH27.pdb.gz	Q5RH27_DANRE TAF3 RNA polymerase II, TATA box-binding protein (TBP)-associated facto OS=Danio rerio OX=7955 GN=fi76b06 PE=4 SV=2
20	AFDB:Q9QZW9	0.050	0.087	3.287E-2	404	0.065	0.126	Q9QZW9.pdb.gz	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80VH0	0.0	976	783	0.665	0.667	BANK1_MOUSE B-cell scaffold protein with ankyrin repeats OS=Mus musculus OX=10090 GN=Bank1 PE=1 SV=3
2	Q8NDB2	0.0	1629	785	1.000	1.000	BANK1_HUMAN B-cell scaffold protein with ankyrin repeats OS=Homo sapiens OX=9606 GN=BANK1 PE=1 SV=3
3	Q6ZUJ8	5.42e-50	191	805	0.250	0.243	BCAP_HUMAN Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2
4	Q9EQ32	6.32e-41	163	811	0.169	0.164	BCAP_MOUSE Phosphoinositide 3-kinase adapter protein 1 OS=Mus musculus OX=10090 GN=Pik3ap1 PE=1 SV=1
5	Q9DDT2	9.38e-35	144	800	0.154	0.151	BCAP_CHICK Phosphoinositide 3-kinase adapter protein 1 OS=Gallus gallus OX=9031 GN=PIK3AP1 PE=1 SV=1
6	A0A0B4KFZ6	8.92e-08	58.5	1029	0.033	0.025	A0A0B4KFZ6_DROME Stumps, isoform D OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
7	A0A0B4KGP0	9.08e-08	58.2	973	0.033	0.027	A0A0B4KGP0_DROME Stumps, isoform F OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
8	Q9VFH9	9.19e-08	58.2	1012	0.033	0.026	Q9VFH9_DROME Stumps, isoform B OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
9	O96757	9.34e-08	58.2	1012	0.033	0.026	O96757_DROME Dof protein OS=Drosophila melanogaster OX=7227 GN=stumps PE=1 SV=1
10	Q9VFI0	1.01e-07	58.2	1220	0.033	0.021	Q9VFI0_DROME Stumps, isoform E OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=3
11	Q1WWH6	1.05e-07	58.2	1211	0.033	0.021	Q1WWH6_DROME RE42507p OS=Drosophila melanogaster OX=7227 GN=stumps PE=2 SV=1
12	O96758	1.14e-07	58.2	1147	0.033	0.023	O96758_DROME Dof protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=stumps PE=2 SV=2
13	E9Q394	0.018	41.2	2776	0.042	0.012	AKP13_MOUSE A-kinase anchor protein 13 OS=Mus musculus OX=10090 GN=Akap13 PE=1 SV=1
14	Q12802	0.049	39.7	2813	0.038	0.011	AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2
15	A8DWJ8	0.060	39.3	1340	0.076	0.045	A8DWJ8_DROME NADPH oxidase, isoform C OS=Drosophila melanogaster OX=7227 GN=Nox PE=4 SV=1
16	A0A0B4LFI7	0.063	39.3	1282	0.076	0.047	A0A0B4LFI7_DROME NADPH oxidase, isoform B OS=Drosophila melanogaster OX=7227 GN=Nox PE=4 SV=1
17	F1M3G7	0.077	39.3	2760	0.038	0.011	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2
18	Q17490	0.092	38.9	6994	0.027	0.003	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
19	Q8N1W1	0.095	38.9	1705	0.025	0.012	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
20	Q9Y4F9	0.17	38.1	1068	0.042	0.031	RIPR2_HUMAN Rho family-interacting cell polarization regulator 2 OS=Homo sapiens OX=9606 GN=RIPOR2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14545 DBB	1.2e-19	82.1	Dof, BCAP, and BANK (DBB) motif,
2	PF11734 TilS_C	3.6e+02	12.0	TilS substrate C-terminal domain
3	PF18567 TIR_3	4e-41	151.5	Toll/interleukin-1 receptor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306253	0.942	Inositol 1,4,5-trisphosphate receptor type 1
2	9606.ENSP00000428924	0.929	Tyrosine-protein kinase Lyn
3	9606.ENSP00000259089	0.905	Tyrosine-protein kinase Blk
4	9606.ENSP00000482457	0.839	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
5	9606.ENSP00000401399	0.781	Myeloid differentiation primary response protein MyD88
6	9606.ENSP00000362680	0.771	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000284486	0.736	Protein FAM167A
8	9606.ENSP00000085219	0.725	B-cell receptor CD22
9	9606.ENSP00000352833	0.696	Tyrosine-protein phosphatase non-receptor type 22
10	9606.ENSP00000370744	0.694	Inositol 1,4,5-trisphosphate receptor type 2
11	9606.ENSP00000349770	0.691	Interferon regulatory factor 5
12	9606.ENSP00000262065	0.686	Monocyte to macrophage differentiation factor
13	9606.ENSP00000376134	0.684	Signal transducer and activator of transcription 4
14	9606.ENSP00000348472	0.681	PX domain-containing protein kinase-like protein
15	9606.ENSP00000264555	0.643	PHD and RING finger domain-containing protein 1
16	9606.ENSP00000378310	0.640	Zinc transporter ZIP8
17	9606.ENSP00000433623	0.608	TNF receptor-associated factor 6
18	9606.ENSP00000281834	0.603	Tumor necrosis factor ligand superfamily member 4
19	9606.ENSP00000404381	0.601	DnaJ homolog subfamily B member 14
20	9606.ENSP00000481570	0.595	Tumor necrosis factor alpha-induced protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035591	0.997	signaling adaptor activity
GO:0005102	0.997	signaling receptor binding
GO:0043274	0.995	phospholipase binding
GO:1990782	0.995	protein tyrosine kinase binding
GO:0002020	0.994	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0007166	0.980	cell surface receptor signaling pathway
GO:0002682	0.979	regulation of immune system process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0048584	0.976	positive regulation of response to stimulus
GO:0002376	0.975	immune system process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0051246	0.969	regulation of protein metabolic process
GO:0048522	0.966	positive regulation of cellular process
GO:0002757	0.965	immune response-activating signaling pathway
GO:0009893	0.880	positive regulation of metabolic process
GO:0010604	0.868	positive regulation of macromolecule metabolic process
GO:0002768	0.825	immune response-regulating cell surface receptor signaling pathway
GO:0032501	0.809	multicellular organismal process
GO:0031399	0.799	regulation of protein modification process
GO:0002429	0.797	immune response-activating cell surface receptor signaling pathway
GO:0042325	0.765	regulation of phosphorylation
GO:0001932	0.755	regulation of protein phosphorylation
GO:0051173	0.706	positive regulation of nitrogen compound metabolic process
GO:0050730	0.618	regulation of peptidyl-tyrosine phosphorylation
GO:0031325	0.585	positive regulation of cellular metabolic process
GO:0001775	0.490	cell activation
GO:0050851	0.456	antigen receptor-mediated signaling pathway
GO:0051247	0.417	positive regulation of protein metabolic process
GO:0046649	0.391	lymphocyte activation
GO:0042113	0.351	B cell activation
GO:0031401	0.330	positive regulation of protein modification process
GO:0050853	0.319	B cell receptor signaling pathway
GO:0010468	0.313	regulation of gene expression
GO:0023051	0.312	regulation of signaling
GO:0010646	0.311	regulation of cell communication
GO:0009966	0.303	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048471	0.995	perinuclear region of cytoplasm
GO:0016020	0.934	membrane
GO:0071944	0.929	cell periphery
GO:0005886	0.897	plasma membrane
GO:0043226	0.791	organelle
GO:0043227	0.765	membrane-bounded organelle
GO:0005829	0.688	cytosol
GO:0043229	0.620	intracellular organelle
GO:0043231	0.452	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]