StarFunc result for job id Q8NDF8

User Input

>input (572 residues)
MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPS
AAVPAADPADSASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGL
HEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDL
VVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNG
VRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPRE
DACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYI
EDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDE
VATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGN
RVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLM
TNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NDF8	1.000	1.000	7.394E-86	572	1.000	1.000	Q8NDF8.pdb.gz	PAPD5_HUMAN Terminal nucleotidyltransferase 4B OS=Homo sapiens OX=9606 GN=TENT4B PE=1 SV=2
2	AFDB:Q7KVS9	0.585	0.338	1.362E-42	1001	0.434	0.248	Q7KVS9.pdb.gz	TRF41_DROME Non-canonical poly(A) RNA polymerase protein Trf4-1 OS=Drosophila melanogaster OX=7227 GN=Trf4-1 PE=1 SV=1
3	AFDB:Q84WU1	0.511	0.550	1.405E-28	530	0.283	0.306	Q84WU1.pdb.gz	Q84WU1_ARATH Nucleotidyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=TRL PE=1 SV=1
4	AFDB:P48561	0.532	0.476	1.027E-25	642	0.264	0.235	P48561.pdb.gz	TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRF5 PE=1 SV=2
5	AFDB:O17087	0.426	0.225	7.723E-17	1113	0.206	0.106	O17087.pdb.gz	GLD2_CAEEL Poly(A) RNA polymerase gld-2 OS=Caenorhabditis elegans OX=6239 GN=gld-2 PE=1 SV=2
6	PDB:4e7xD	0.404	0.689	3.611E-16	320	0.142	0.253	4e7xD.pdb.gz
7	PDB:4ud5B	0.408	0.657	4.199E-16	342	0.128	0.213	4ud5B.pdb.gz
8	AFDB:Q641A1	0.445	0.497	5.368E-14	509	0.152	0.171	Q641A1.pdb.gz	GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis OX=8355 GN=tent2-a PE=1 SV=1
9	AFDB:Q5U315	0.441	0.517	1.797E-13	484	0.142	0.167	Q5U315.pdb.gz	GLD2_RAT Poly(A) RNA polymerase GLD2 OS=Rattus norvegicus OX=10116 GN=Tent2 PE=1 SV=1
10	PDB:2q0eA	0.376	0.618	1.557E-11	331	0.107	0.184	2q0eA.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
11	PDB:3hj1B	0.400	0.574	1.835E-10	387	0.098	0.145	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
12	PDB:2b51A	0.389	0.490	9.662E-10	444	0.115	0.149	2b51A.pdb.gz	Structural basis for UTP specificity of RNA editing TUTases from Trypanosoma brucei.
13	PDB:2q0cB	0.332	0.568	9.662E-10	311	0.098	0.180	2q0cB.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
14	PDB:3c66A	0.362	0.385	6.544E-9	529	0.110	0.119	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
15	AFDB:A0A024R6M3	0.375	0.295	2.346E-8	745	0.147	0.113	A0A024R6M3.pdb.gz
16	PDB:4rwnA	0.341	0.523	2.615E-6	349	0.096	0.158	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
17	PDB:5wyjCB	0.353	0.198	2.615E-6	1098	0.070	0.036	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
18	PDB:2nomB	0.256	0.532	6.805E-6	255	0.091	0.204	2nomB.pdb.gz	UTP-bound and Apo Structures of a Minimal RNA Uridylyltransferase.
19	AFDB:Q9H4A3	0.093	0.039	5.468E-1	2382	0.156	0.037	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
20	AFDB:A0A0B4LEZ1	0.062	0.037	6.360E-1	1260	0.065	0.029	A0A0B4LEZ1.pdb.gz	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G4U4J3	0.0	966	631	0.967	0.876	G4U4J3_HUMAN PAP associated domain containing 5 OS=Homo sapiens OX=9606 GN=PAPD5 PE=2 SV=1
2	Q5XG87	0.0	549	772	0.503	0.373	PAPD7_HUMAN Terminal nucleotidyltransferase 4A OS=Homo sapiens OX=9606 GN=TENT4A PE=1 SV=4
3	Q8NDF8	0.0	1191	572	1.000	1.000	PAPD5_HUMAN Terminal nucleotidyltransferase 4B OS=Homo sapiens OX=9606 GN=TENT4B PE=1 SV=2
4	Q7KVS9	1.75e-139	431	1001	0.379	0.217	TRF41_DROME Non-canonical poly(A) RNA polymerase protein Trf4-1 OS=Drosophila melanogaster OX=7227 GN=Trf4-1 PE=1 SV=1
5	Q84WU1	1.76e-69	235	530	0.234	0.253	Q84WU1_ARATH Nucleotidyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=TRL PE=1 SV=1
6	Q9UTN3	2.98e-67	233	684	0.250	0.209	CID14_SCHPO Poly(A) RNA polymerase cid14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid14 PE=1 SV=2
7	P53632	2.26e-58	206	584	0.206	0.202	PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAP2 PE=1 SV=1
8	G5EFL0	5.34e-56	204	845	0.222	0.150	GLD4_CAEEL Poly(A) RNA polymerase gld-4 OS=Caenorhabditis elegans OX=6239 GN=gld-4 PE=1 SV=1
9	P48561	1.04e-53	195	642	0.201	0.179	TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRF5 PE=1 SV=2
10	Q5B186	2.99e-44	169	694	0.191	0.157	Q5B186_EMENI polynucleotide adenylyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05694 PE=3 SV=1
11	Q57VP5	1.59e-39	156	746	0.187	0.143	Q57VP5_TRYB2 DNA polymerase sigma, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.140 PE=4 SV=1
12	F4JH01	1.07e-29	127	1481	0.175	0.068	F4JH01_ARATH Nucleotidyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=MEE44 PE=1 SV=1
13	O74518	1.85e-27	115	336	0.143	0.244	CID12_SCHPO Poly(A) RNA polymerase cid12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid12 PE=1 SV=1
14	O64642	1.43e-20	98.2	764	0.129	0.097	URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=URT1 PE=1 SV=2
15	O13833	7.84e-14	75.9	405	0.154	0.217	CID1_SCHPO Terminal uridylyltransferase cid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid1 PE=1 SV=2
16	O74326	1.12e-12	72.8	478	0.110	0.132	CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid11 PE=3 SV=1
17	Q57WQ6	1.24e-10	66.2	488	0.119	0.139	Q57WQ6_TRYB2 DNA polymerase sigma-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.760 PE=4 SV=1
18	Q5BLK4	2.95e-10	65.9	1491	0.089	0.034	TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus OX=10090 GN=Tut7 PE=1 SV=3
19	O17087	3.68e-10	65.5	1113	0.105	0.054	GLD2_CAEEL Poly(A) RNA polymerase gld-2 OS=Caenorhabditis elegans OX=6239 GN=gld-2 PE=1 SV=2
20	X6R3Q3	4.92e-10	64.7	784	0.087	0.064	X6R3Q3_HUMAN RNA uridylyltransferase OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01909 NTP_transf_2	6e-12	57.0	Nucleotidyltransferase domain
2	PF03828 PAP_assoc	8.8e-11	53.2	Cid1 family poly A polymerase
3	PF18765 Polbeta	1.5	20.4	Polymerase beta, Nucleotidyltransferase
4	PF19088 TUTase	52	14.6	TUTase nucleotidyltransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006049008.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006074218.1	0.988	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
2	89462.XP_006063557.1	0.982	Zinc finger CCHC domain-containing protein 7 isoform X1
3	89462.XP_006047250.1	0.962	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns
4	89462.XP_006047778.1	0.910	DNA polymerase sigma isoform X1
5	89462.XP_006046193.1	0.901	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
6	89462.XP_006064702.1	0.901	Zinc finger CCHC domain-containing protein 2
7	89462.XP_006041070.1	0.900	NFX1-type zinc finger-containing protein 1
8	89462.XP_006076859.1	0.866	Exosome component 10
9	89462.XP_006053623.1	0.828	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
10	89462.XP_006043013.1	0.796	Cellular nucleic acid-binding protein-like
11	89462.XP_006049636.1	0.796	Zinc finger CCHC domain-containing protein 3
12	89462.XP_006065176.1	0.796	Zinc finger CCHC domain-containing protein 9
13	89462.XP_006075894.1	0.796	Cellular nucleic acid-binding protein-like
14	89462.XP_006078915.1	0.796	Cellular nucleic acid-binding protein isoform X1
15	89462.XP_006064015.1	0.762	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
16	89462.XP_006066618.1	0.753	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments
17	89462.XP_006039594.1	0.741	Helicase SKI2W-like
18	89462.XP_006041934.1	0.741	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
19	89462.XP_006059249.1	0.741	Helicase SKI2W-like
20	89462.XP_006049010.1	0.740	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0070568	0.999	guanylyltransferase activity
GO:0070034	0.999	telomerase RNA binding
GO:0004652	0.999	polynucleotide adenylyltransferase activity
GO:0140098	0.375	catalytic activity, acting on RNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.966	cellular process
GO:0006396	0.964	RNA processing
GO:0050789	0.936	regulation of biological process
GO:0031123	0.936	RNA 3'-end processing
GO:0050794	0.932	regulation of cellular process
GO:0048522	0.918	positive regulation of cellular process
GO:1902373	0.916	negative regulation of mRNA catabolic process
GO:0010629	0.912	negative regulation of gene expression
GO:0051173	0.890	positive regulation of nitrogen compound metabolic process
GO:0034660	0.864	ncRNA metabolic process
GO:0016071	0.855	mRNA metabolic process
GO:0043631	0.847	RNA polyadenylation
GO:0033044	0.826	regulation of chromosome organization
GO:0006401	0.821	RNA catabolic process
GO:0010608	0.807	post-transcriptional regulation of gene expression
GO:0034470	0.782	ncRNA processing
GO:0043487	0.755	regulation of RNA stability
GO:0031325	0.742	positive regulation of cellular metabolic process
GO:0034661	0.732	ncRNA catabolic process
GO:0043488	0.716	regulation of mRNA stability
GO:0010556	0.683	regulation of macromolecule biosynthetic process
GO:0031326	0.683	regulation of cellular biosynthetic process
GO:0006417	0.672	regulation of translation
GO:1904356	0.668	regulation of telomere maintenance via telomere lengthening
GO:0006402	0.662	mRNA catabolic process
GO:0016074	0.651	sno(s)RNA metabolic process
GO:0010558	0.629	negative regulation of macromolecule biosynthetic process
GO:0031327	0.627	negative regulation of cellular biosynthetic process
GO:0043144	0.610	sno(s)RNA processing
GO:2000278	0.606	regulation of DNA biosynthetic process
GO:0031124	0.591	mRNA 3'-end processing
GO:0032210	0.589	regulation of telomere maintenance via telomerase
GO:0006378	0.580	mRNA polyadenylation
GO:2001251	0.564	negative regulation of chromosome organization
GO:0043628	0.548	regulatory ncRNA 3'-end processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	1.000	nuclear lumen
GO:0016020	0.997	membrane
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0032991	0.988	protein-containing complex
GO:0005886	0.985	plasma membrane
GO:0005829	0.984	cytosol
GO:0005730	0.915	nucleolus
GO:0140513	0.548	nuclear protein-containing complex
GO:0031499	0.432	TRAMP complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11332	0.999	ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide
EC:2.7.7.19	0.999	polynucleotide adenylyltransferase.

[back to server]