StarFunc result for job id Q8NDG6

User Input

>input (1382 residues)
MLRKLTIEQINDWFTIGKTVTNVELLGAPPAFPAGAAREEVQRQDVAPGAGPAAQAPALA
QAPARPAAAFERSLSQRSSEVEYINKYRQLEAQELDVCRSVQPTSGPGPRPSLAKLSSVT
CIPGTTYKYPDLPISRYKEEVVSLIESNSVVIIHGATGSGKSTQLPQYILDHYVQRSAYC
SIVVTQPRKIGASSIARWISKERAWTLGGVVGYQVGLEKIATEDTRLIYMTTGVLLQKIV
SAKSLMEFTHIIIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVVLMSATISCKEFADYFA
VPVQNKMNPAYIFEVEGKPHSVEEYYLNDLEHIHHSKLSPHLLEEPVITKDIYEVAVSLI
QMFDDLDMKESGNKAWSGAQFVLERSSVLVFLPGLGEINYMHELLTSLVHKRLQVYPLHS
SVALEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSL
RLSWASKTSCNQRKGRAGRVSRGYCYRLVHKDFWDNSIPDHVVPEMLRCPLGSTILKVKL
LDMGEPRALLATALSPPGLSDIERTILLLKEVGALAVSGQREDENPHDGELTFLGRVLAQ
LPVNQQLGKLIVLGHVFGCLDECLIIAAALSLKNFFAMPFRQHLDGYRNKVNFSGSSKSD
CIALVEAFKTWKACRQTGELRYPKDELNWGRLNYIQIKRIREVAELYEELKTRISQFNMH
VDSRRPVMDQEYIYKQRFILQVVLAGAFYPNYFTFGQPDEEMAVRELAGKDPKTTVVLKH
IPPYGFLYYKQLQSLFRQCGQVKSIVFDGAKAFVEFSRNPTERFKTLPAVYMAIKMSQLK
VSLELSVHSAEEIEGKVQGMNVSKLRNTRVNVDFQKQTVDPMQVSFNTSDRSQTVTDLLL
TIDVTEVVEVGHFWGYRIDENNSEILKKLTAEINQLTLVPLPTHPHPDLVCLAPFADFDK
QRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLLMEIPCQFLELPFQALEFKICKMRPSA
KSLVCGKHWSDGASQWFASLVSGCTLLVKVFSVVHSVLHVDVYQYSGVQDAINIRDVLIQ
QGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPMKDDEKYLIRILLESFSTNKL
GTPNCKAELHGPFNPYELKCHSLTRISKFRCVWIEKESINSVIISDAPEDLHQRMLVAAS
LSINATGSTMLLRETSLMPHIPGLPALLSMLFAPVIELRIDQNGKYYTGVLCGLGWNPAT
GASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIAR
QKLLGLFCQSKPREKIVPKWHEKPYEWNQVDPKLVMEQADRESSRGKNTFLYQLHKLVVL
GT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14BI7	0.965	0.965	0.000	1383	0.863	0.862	Q14BI7.pdb.gz	TDRD9_MOUSE ATP-dependent RNA helicase TDRD9 OS=Mus musculus OX=10090 GN=Tdrd9 PE=1 SV=3
2	AFDB:Q8NDG6	1.000	1.000	0.000	1382	1.000	1.000	Q8NDG6.pdb.gz	TDRD9_HUMAN ATP-dependent RNA helicase TDRD9 OS=Homo sapiens OX=9606 GN=TDRD9 PE=2 SV=3
3	AFDB:Q9VF26	0.784	0.757	0.000	1434	0.304	0.293	Q9VF26.pdb.gz	SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster OX=7227 GN=spn-E PE=2 SV=1
4	AFDB:F4ILR7	0.363	0.493	2.614E-53	995	0.165	0.229	F4ILR7.pdb.gz	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
5	AFDB:Q7Z478	0.407	0.410	2.741E-51	1369	0.155	0.156	Q7Z478.pdb.gz	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
6	AFDB:F4HYJ6	0.388	0.441	2.889E-51	1206	0.161	0.184	F4HYJ6.pdb.gz	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
7	AFDB:Q05B79	0.347	0.462	1.185E-50	1010	0.162	0.222	Q05B79.pdb.gz	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
8	AFDB:O70133	0.387	0.387	3.371E-50	1380	0.162	0.162	O70133.pdb.gz	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
9	AFDB:Q382X0	0.389	0.413	1.796E-49	1299	0.144	0.153	Q382X0.pdb.gz	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
10	AFDB:B0S6Z1	0.390	0.423	3.934E-49	1271	0.154	0.168	B0S6Z1.pdb.gz
11	PDB:5aorA	0.388	0.525	4.153E-46	1009	0.151	0.207	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
12	PDB:5vheA	0.381	0.593	3.182E-44	871	0.150	0.238	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
13	PDB:5n9dB	0.388	0.604	3.353E-44	866	0.148	0.236	5n9dB.pdb.gz	Molecular Mechanistic Insights into Drosophila DHX36-Mediated G-Quadruplex Unfolding: A Structure-Based Model.
14	PDB:6id1V	0.379	0.768	3.345E-43	663	0.124	0.259	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:5xjcY	0.372	0.699	4.334E-42	713	0.124	0.240	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:6ff7q	0.367	0.782	1.000E-41	625	0.124	0.275	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:3kx2B	0.375	0.668	4.801E-41	755	0.122	0.224	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
18	PDB:5ylzW	0.362	0.686	8.512E-40	703	0.119	0.233	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
19	PDB:7dcpx	0.376	0.751	7.648E-39	670	0.122	0.251	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:5wsge	0.365	0.708	1.159E-37	679	0.122	0.249	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14BI7	0.0	2472	1383	0.863	0.863	TDRD9_MOUSE ATP-dependent RNA helicase TDRD9 OS=Mus musculus OX=10090 GN=Tdrd9 PE=1 SV=3
2	Q8NDG6	0.0	2868	1382	1.000	1.000	TDRD9_HUMAN ATP-dependent RNA helicase TDRD9 OS=Homo sapiens OX=9606 GN=TDRD9 PE=2 SV=3
3	Q9VF26	0.0	620	1434	0.313	0.301	SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster OX=7227 GN=spn-E PE=2 SV=1
4	F4ILR7	5.56e-98	340	995	0.161	0.224	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
5	Q08211	1.26e-89	320	1270	0.159	0.173	DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4
6	Q6P158	2.10e-89	321	1386	0.151	0.151	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
7	Q28141	1.28e-88	317	1287	0.158	0.170	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
8	E7EWK3	1.68e-87	305	797	0.148	0.257	E7EWK3_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=1
9	Q6PGC1	3.76e-87	314	1365	0.148	0.149	DHX29_MOUSE ATP-dependent RNA helicase DHX29 OS=Mus musculus OX=10090 GN=Dhx29 PE=1 SV=1
10	Q05B79	5.34e-87	308	1010	0.148	0.202	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
11	P24785	1.27e-86	311	1293	0.150	0.160	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
12	D4A2Z8	1.53e-86	307	1000	0.147	0.203	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
13	Q7Z478	1.64e-86	312	1369	0.144	0.145	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
14	Q8VHK9	1.77e-86	306	1001	0.146	0.202	DHX36_MOUSE ATP-dependent DNA/RNA helicase DHX36 OS=Mus musculus OX=10090 GN=Dhx36 PE=1 SV=2
15	O70133	8.74e-86	310	1380	0.160	0.160	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
16	Q9H2U1	9.98e-86	305	1008	0.148	0.203	DHX36_HUMAN ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2
17	Q8SWT2	1.33e-82	294	942	0.151	0.221	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
18	F4HYJ6	4.98e-80	291	1206	0.149	0.171	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
19	A2BIE5	4.33e-79	287	1150	0.155	0.186	A2BIE5_DANRE DEAH (Asp-Glu-Ala-His) box polypeptide 34 OS=Danio rerio OX=7955 GN=si:ch211-255l12.1 PE=1 SV=2
20	Q581T1	2.10e-77	286	2167	0.153	0.098	REH2_TRYB2 RNA editing associated helicase 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=REH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	8.2	17.9	AAA domain
2	PF13245 AAA_19	46	15.7	AAA domain
3	PF13401 AAA_22	21	16.8	AAA domain
4	PF13476 AAA_23	4.2e+02	12.8	AAA domain
5	PF13555 AAA_29	3.7e+02	12.3	P-loop containing region of AAA domain
6	PF00270 DEAD	1.2e-05	36.6	DEAD/DEAH box helicase
7	PF01580 FtsK_SpoIIIE	75	14.1	FtsK/SpoIIIE family
8	PF04408 HA2	2.8e-09	48.5	Helicase associated domain (HA2)
9	PF00271 Helicase_C	1.4e-09	49.6	Helicase conserved C-terminal domain
10	PF02562 PhoH	4.8e+02	11.6	PhoH-like protein
11	PF00437 T2SSE	1.6e+02	12.7	Type II/IV secretion system protein
12	PF00567 TUDOR	7.9e-11	53.5	Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387303

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299001	0.998	Piwi-like protein 4
2	9606.ENSP00000356846	0.984	Protein maelstrom homolog
3	9606.ENSP00000359049	0.979	Small RNA 2'-O-methyltransferase
4	9606.ENSP00000252037	0.976	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
5	9606.ENSP00000262794	0.967	RNA helicase Mov10l1
6	9606.ENSP00000349208	0.960	Piwi-like protein 2
7	9606.ENSP00000390621	0.958	Putative ATP-dependent RNA helicase TDRD12
8	9606.ENSP00000284629	0.930	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
9	9606.ENSP00000406052	0.930	Tudor domain-containing protein 5
10	9606.ENSP00000335153	0.922	Heat shock protein HSP 90-alpha
11	9606.ENSP00000424838	0.900	Probable ATP-dependent RNA helicase DDX4
12	9606.ENSP00000347444	0.887	Tudor domain-containing protein 7
13	9606.ENSP00000348132	0.882	Serine/threonine kinase 31
14	9606.ENSP00000357812	0.877	Tudor and KH domain-containing protein
15	9606.ENSP00000251864	0.862	Tudor domain-containing protein 1
16	9606.ENSP00000446485	0.826	Gametocyte-specific factor 1
17	9606.ENSP00000245255	0.824	Piwi-like protein 1
18	9606.ENSP00000330031	0.806	Piwi-like protein 3
19	9606.ENSP00000317177	0.736	Mitochondrial cardiolipin hydrolase
20	9606.ENSP00000357465	0.698	Tudor domain-containing protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016887	0.996	ATP hydrolysis activity
GO:0003676	0.950	nucleic acid binding
GO:0003723	0.881	RNA binding
GO:0140640	0.803	catalytic activity, acting on a nucleic acid
GO:0004386	0.356	helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048232	0.985	male gamete generation
GO:0003006	0.972	developmental process involved in reproduction
GO:0009987	0.944	cellular process
GO:0007283	0.904	spermatogenesis
GO:0065007	0.774	biological regulation
GO:0050789	0.752	regulation of biological process
GO:0050794	0.624	regulation of cellular process
GO:0071704	0.598	organic substance metabolic process
GO:0044238	0.597	primary metabolic process
GO:0006807	0.584	nitrogen compound metabolic process
GO:0044237	0.575	cellular metabolic process
GO:0019222	0.565	regulation of metabolic process
GO:0043170	0.563	macromolecule metabolic process
GO:0060255	0.554	regulation of macromolecule metabolic process
GO:0034641	0.553	cellular nitrogen compound metabolic process
GO:0090304	0.530	nucleic acid metabolic process
GO:0010468	0.453	regulation of gene expression
GO:0016070	0.436	RNA metabolic process
GO:0010467	0.406	gene expression
GO:0006396	0.328	RNA processing
GO:0071840	0.324	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.991	nuclear lumen
GO:0005654	0.963	nucleoplasm
GO:0043232	0.936	intracellular non-membrane-bounded organelle
GO:0005829	0.870	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.996	ATP + H2O = ADP + H(+) + phosphate

[back to server]