StarFunc result for job id Q8NDH2

User Input

>input (2452 residues)
MAQIQKDKANISEKSVMHPEYIAVKAEKSPLSHILKTKELQVNISQQGEKAQEGEVEIVV
LLSKTCPFVTSSAFLELDSIKEEEGEPRITRSFMPHLEIQESLPSRQTAPTKPTESLVKK
EKQLLPQKEDRVQTVSMHGLMHPNGAVFKAKTSAPPQVFSITEHSPLSKRKEPQWGMKER
AGQKQDRTGRPHVILTKTHPFMPSLSHHRFSPSQPKLPISSGAGKSRLANSNEGISSHKV
ILKANQQMPYKEAKDRVKIEGREGRILPKRIHLRAEALPLALLCNGKNYSLHIEEQGEGV
QESKKEPGVVPRKSASFPPPPFYLNCDTRRNEKEGTLGKTQFSFPPLKIQDSSDSGKKAY
TESLHGYTLSNSKGPVQPTAQGEEKGGLRIDMEDKMLPKCTDLKAKQLLLSDILNTKKLQ
WKSKEQKRKIQEDKNKQVKGLPSINTSLLTPPYLKFDTTEGQENVIRIAKVSLPQSRSKE
SSDAGRIACPEATHGELSSDVKQLKAHLLQKEEKDREKVADMTSVLDPNKMYLKAKKSPV
LHTHSFSDLQWKTREQEEEKVQKVKSGPGVMLSKSPSRSSPLHLNVNTGFQEESIPILTR
PSFPLVKLQVSPDTEGGTCIRPIAGDILIYLQKGKHVSQNKEEDDVQIVSILIFPKHQEE
KVQECEGEPGVVLTKSTSLPSLSQLELDKETHLGNEMLRLKRPILRRISHIGETVHRESV
VGDIPKDVKNEKQHIPQKEERNQKKIIDMRGTDITLKSKKSPRSCMLHRTELHVNIGGQG
RKEHEGQDKPPGMIQRKMCILFSKPLPSNLKLERATHADEERLGGKTSFVLPLMPSALPD
TEKTADAEARSGDVRKGKPHRSQKENRHEVKTIDMRFRIHCQEARISPMSHILNAKELVL
NINKLEKKVHKDKDEACVVLSRTFLSIPSAPPLYLDSGNKTDKDTPGITGSSCPQRTLHV
PSNTQKITNRDSVEGVDKNVVKQAEQYVPRPEAEQQLTSNFMISVQQRNQPSRVRSEEDL
NQLVLNSRDEDIYFTGFGTIRSGKRPEWLFTGKKAQPVKYKTETLTAFLSYPTMDATKMG
GLEEDTEIMDNLNHKISPKASVSLIRKISKELYVTLGTPANSKGFSVSERYAHQQETSSK
VSPELAGSCKFDKPKEDGQSNDRISKMFSPKVLAPQTKGSLKKISIVTNWNAPQNIEEQD
IVMKKQVIRRCEHGHKTRTNTILSKFPLQSGKQKTPSETDVDKKTTAHLSLQMLPGIHMD
MTEIDPAKGGRKQALLISEQEEGVLEFLPKSLFPPWTFQFQSGDLEEKHQTDANTNINLE
QKKLEMDNDSTVNQKEGKLKIGTNRALHLQEEKTEMHKARTANLEKERGRMDTSSSAHPH
LLSLKAEESQMKTQVITHRENSRLIMQKQKKELEASNAKQSIQLQKLFQRNVLDSFYSYV
PLSPKRKDQKGRLTIRDLKRELSTKYLTMKIQNHPIPQMLNITGRGTPSNRKKLEYDVKL
KNIASWSKDVSGIFIRSLSISIMRSPHTDPKTNLEREKRICLPKFQEKSPNTSEMSKRDT
LTIVKGEQNFTNTVPQDPQPFAVDKQQMQKLPNVKSEANLRSEMNKKYLKAQTKERIVPE
HDVSRIIKKPDLRIIEQEEKILKRILTPTECPSMLEDPKLPKQRDQSEPVWDMTTQKVQQ
QKAFPGTVPIPPQVKSSEVKIVADSTNAEHLLPICEATKAISESQVKNMIQDKVSSDKLD
NIQAYKPDDLKSPPFPEGPDTISTAIYPKTQHKSLLEQFTPKEKNKLTSHLESKALEIQL
NLIPEMARKSLQMFNFYPKGTISKDNSWRFYSRHKTMNFMSLEGTDTIEPNSKHKHQKDS
PLASNMKTLIVDVSSDSEETITKLQSINKLENGTSAVTSASEMLLPHTLQNHSVKEKGKL
LMHFSVKTLEIQMKAFPRIVRESYAMTSAHERKKPLSNCIHPGFTGPKRQNRILLLSEEK
SLHQIDLDLQYKYLRFLLGLPVGSTFPKPNVLPKHSKLNTIAVCKNVNAGGQSGSLSIDT
ELLEQHISFKKQSPHENSSLIRKFPQPTLVCASDRDLHSPRKKDTQVLSESEFHVTPEKN
KQYHVWFQERNTCESVDLRTQRNATGSAVSCETQISEDFVDIQTDIESPADLDECSCLEV
SESEECVFLEANSYLSQESENILFELQTGIPLENVYKITTDLKSFYSEDSGSHCTRECRK
ETLIITPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKS
RTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRKNSSHWDHDYSCTHSKG
KRDRKKRVYDYESERLDCFQSKHKSASKPHHDDINFYSERKQNRPFFFACVPADSLEVIP
KTIRWTIPPETLRKRNFRIPLVAKISSSWNIWSSSKKLLGSLSGSLTTVFHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VQM0	0.030	0.032	1.269E-5	2162	0.133	0.150	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
2	AFDB:Q9VRM6	0.032	0.037	5.170E-5	1929	0.115	0.146	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
3	AFDB:Q8IQT4	0.026	0.029	1.259E-3	2133	0.100	0.115	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
4	AFDB:Q96QE3	0.029	0.034	2.709E-3	1844	0.075	0.099	Q96QE3.pdb.gz	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
5	AFDB:E7F630	0.028	0.028	3.280E-3	2394	0.126	0.129	E7F630.pdb.gz
6	AFDB:Q09MP3	0.025	0.045	3.727E-3	1159	0.064	0.135	Q09MP3.pdb.gz	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
7	AFDB:E9Q842	0.027	0.027	4.812E-3	2432	0.111	0.112	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
8	AFDB:Q8IVL1	0.026	0.023	5.467E-3	2488	0.115	0.113	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
9	AFDB:Q4QY64	0.030	0.037	6.622E-3	1826	0.078	0.105	Q4QY64.pdb.gz	ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus OX=10090 GN=Atad5 PE=1 SV=1
10	AFDB:Q3LHL9	0.024	0.029	1.176E-2	1658	0.090	0.133	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
11	PDB:3javA	0.033	0.034	1.077E-1	2327	0.111	0.117	3javA.pdb.gz
12	PDB:7ajuCK	0.014	0.095	4.659	222	0.011	0.117	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:7mqaNA	0.023	0.091	4.966	295	0.018	0.146	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7suk6	0.014	0.087	7.764	277	0.007	0.058	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:6wucH	0.020	0.225	8.276	179	0.005	0.073	6wucH.pdb.gz
16	PDB:4n8eB	0.010	0.032	8.822	734	0.003	0.010	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3MHY7	1.5	35.8	262	0.023	0.218	RM10_BOVIN Large ribosomal subunit protein uL10m OS=Bos taurus OX=9913 GN=MRPL10 PE=1 SV=2
2	Q8IIY3	1.7	35.8	330	0.014	0.103	Q8IIY3_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1101300 PE=4 SV=1
3	Q9UKZ4	1.9	36.6	2725	0.017	0.015	TEN1_HUMAN Teneurin-1 OS=Homo sapiens OX=9606 GN=TENM1 PE=1 SV=2
4	Q9WTS4	2.2	36.2	2731	0.017	0.015	TEN1_MOUSE Teneurin-1 OS=Mus musculus OX=10090 GN=Tenm1 PE=1 SV=1
5	Q03049	2.8	35.4	344	0.012	0.087	YD541_YEAST Putative uncharacterized oxidoreductase YDR541C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR541C PE=3 SV=2
6	O22176	3.9	34.7	317	0.013	0.104	WRK15_ARATH Probable WRKY transcription factor 15 OS=Arabidopsis thaliana OX=3702 GN=WRKY15 PE=2 SV=1
7	Q38BU4	4.8	35.0	1223	0.009	0.018	Q38BU4_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4540 PE=4 SV=1
8	Q7Z7H8	6.1	33.9	261	0.017	0.161	RM10_HUMAN Large ribosomal subunit protein uL10m OS=Homo sapiens OX=9606 GN=MRPL10 PE=1 SV=3
9	Q8NF91	8.0	34.3	8797	0.015	0.004	SYNE1_HUMAN Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4
10	A0A0C4DG40	8.4	34.3	8749	0.015	0.004	A0A0C4DG40_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15804 CCDC168_N	9.4e-161	543.3	Coiled-coil domain-containing protein 168

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320232

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359376	0.731	Solute carrier family 17 member 9
2	9606.ENSP00000219481	0.717	Peroxisomal 2,4-dienoyl-CoA reductase
3	9606.ENSP00000261514	0.696	H(+)/Cl(-) exchange transporter 3
4	9606.ENSP00000410186	0.686	Adenylate kinase 9
5	9606.ENSP00000200453	0.660	Protein phosphatase 1 regulatory subunit 15A
6	9606.ENSP00000267199	0.633	Vacuolar protein sorting-associated protein 33A
7	9606.ENSP00000410533	0.629	Ring finger protein 223
8	9606.ENSP00000442460	0.624	Protein-tyrosine kinase 6
9	9606.ENSP00000293725	0.604	Zinc finger protein 563
10	9606.ENSP00000426421	0.596	Protein asteroid homolog 1
11	9606.ENSP00000340523	0.591	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
12	9606.ENSP00000328133	0.586	Interleukin-20 receptor subunit beta
13	9606.ENSP00000324292	0.522	Fas-binding factor 1
14	9606.ENSP00000320794	0.518	Basic helix-loop-helix domain-containing protein USF3
15	9606.ENSP00000473348	0.518	GDH/6PGL endoplasmic bifunctional protein
16	9606.ENSP00000344403	0.517	Plays a role in spermatogenesis.
17	9606.ENSP00000366135	0.513	Exosome component 10
18	9606.ENSP00000387523	0.510	Olfactory receptor 7E24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.742	biological regulation
GO:0050789	0.726	regulation of biological process
GO:0050794	0.597	regulation of cellular process
GO:0009987	0.373	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.947	cytoplasm
GO:0005634	0.929	nucleus
GO:0070013	0.805	intracellular organelle lumen
GO:0031982	0.445	vesicle
GO:0005576	0.440	extracellular region
GO:0016604	0.416	nuclear body
GO:0005615	0.376	extracellular space
GO:0070062	0.365	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]