StarFunc result for job id Q8NDM7

User Input

>input (1665 residues)
MAQGRERDEGPHSAGGASLSVRWVQGFPKQNVHFVNDNTICYPCGNYVIFINIETKKKTV
LQCSNGIVGVMATNIPCEVVAFSDRKLKPLIYVYSFPGLTRRTKLKGNILLDYTLLSFSY
CGTYLASYSSLPEFELALWNWESSIILCKKSQPGMDVNQMSFNPMNWRQLCLSSPSTVSV
WTIERSNQEHCFRARSVKLPLEDGSFFNETDVVFPQSLPKDLIYGPVLPLSAIAGLVGKE
AETFRPKDDLYPLLHPTMHCWTPTSDLYIGCEEGHLLMINGDTLQVTVLNKIEEESPLDR
RNFISPVTLVYQKEGVLASGIDGFVYSFIIKDRSYMIEDFLEIERPVEHMTFSPNYTVLL
IQTDKGSVYIYTFGKEPTLNKVLDACDGKFQAIDFITPGTQYFMTLTYSGEICVWWLEDC
ACVSKIYLNTLATVLACCPSSLSAAVGTEDGSVYFISVYDKESPQVVHKAFLSESSVQHV
VYDQQGIFLLVGTAEGKVFIINANSSSSFQIIGFTEVAKDILQISTVSLLETDIVEVMVL
SSLPEAGRSRLEMFTLPTLLPQVSTTFADERGRLKDEIIHKYLYELEHALSSAVLGFQSN
QIYGFCSQVPYICSYLLPEEEHTGIYILKPYKKVQSRQYGPGLLYLSSHGLWLITIAKCG
ILCIRDVYTLETFAWCRSHSHQGHGIQSMRISMDGQNILVNGRDDGTLVYLKWKRFGGHL
ASEILDYYQKLLISLSSAMDKENHYLSTTPKVSVDLGSDSEHTKQKASTDLSQDELVLTD
VKKEIPWIQQKSQEAIKKEVNLFSKKRKEIKQGIKSLSKTILNMMEENDKLENIAKLDQQ
EFGLDLEELERLHDESQEEVAKMIKDVEMHNLAKSYLAELIKEECWNSMAVKGRALKCFH
IPCVVENFPMKARTVEELKELERVLQQKKIEAECLKLRKEIVEAQSGVKLIKQRHEEDDE
EEEEEDKTVKYSNLPNYLLGSLSTDFGVDTSLLSSQLELHSREEKINQIILLKDIIYKVK
TVFNNEFDAAYKQKEFEIARVKERNVRIREIILDLELEEAVWQPEFEDCEKPERTLVVQD
EEITAHKHIKPWHKAKELIVNHEKEHWLLIQDASTRLRALMDMMGGVLEVKKEDILRMVI
PQPAFMAKPDAVWTEEERKQFKDYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQAF
DEHLKRLFERRVKAEMVTNQEELKISNLAFSLLLDEELSSREKFLNNYLTRKQHEKSQTS
EAVRKSREDLDVCKEHYDNLLAEDKVMDRSFKKEFSEIPGHQVDILYKLFKRRPRISKQK
THSETTSVVPFGELPGSGKLNKDAFAQLMKAMDELDNISNMPEGLDPLVWNHFCMTRRAK
VENEQKVKQKAADLLEMATFLQKRVEEEEKVQQEIERVFHELILLQEEKVRFQLNLTIQI
LLKQGQVELENFQLVLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKDVHKRILQI
EWEHKKMEMEREDLNQKAWDIQMLFFSRDRQKYLNEPNYEALISIQIGIMEQTIAVLDKM
HKKNVENCKKLLKKLGKFSNQKDIANYALSCNLREELVAVSERKDICNAMGSKLTCEKIV
KERYENMMQQQKLTNISKQQAEQISILQTEVERLRMKTFPALVQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1L8GXY4	0.445	0.457	0.000	1621	0.449	0.461	A0A1L8GXY4.pdb.gz	CFA43_XENLA Cilia- and flagella-associated protein 43 OS=Xenopus laevis OX=8355 GN=cfap43 PE=2 SV=1
2	AFDB:E9Q7R9	0.788	0.781	0.000	1682	0.734	0.727	E9Q7R9.pdb.gz	CFA43_MOUSE Cilia- and flagella-associated protein 43 OS=Mus musculus OX=10090 GN=Cfap43 PE=1 SV=1
3	AFDB:Q8NDM7	1.000	1.000	0.000	1665	1.000	1.000	Q8NDM7.pdb.gz	CFA43_HUMAN Cilia- and flagella-associated protein 43 OS=Homo sapiens OX=9606 GN=CFAP43 PE=1 SV=3
4	AFDB:Q96MT7	0.339	0.307	1.213E-55	1854	0.150	0.135	Q96MT7.pdb.gz	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
5	AFDB:A8J1V4	0.329	0.313	3.364E-55	1764	0.164	0.155	A8J1V4.pdb.gz	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
6	AFDB:Q57YQ1	0.357	0.402	1.755E-54	1460	0.163	0.186	Q57YQ1.pdb.gz	Q57YQ1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.870 PE=4 SV=1
7	AFDB:E9Q5M6	0.350	0.319	2.131E-54	1843	0.146	0.132	E9Q5M6.pdb.gz	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
8	AFDB:Q57WH1	0.308	0.293	5.910E-54	1760	0.150	0.141	Q57WH1.pdb.gz	CFA44_TRYB2 Cilia- and flagella-associated protein 44 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=CFAP44 PE=3 SV=1
9	AFDB:Q57UW5	0.317	0.430	1.565E-33	1204	0.136	0.189	Q57UW5.pdb.gz	Q57UW5_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.570 PE=4 SV=1
10	AFDB:Q5U0T8	0.310	0.429	7.407E-33	1171	0.105	0.149	Q5U0T8.pdb.gz	Q5U0T8_DROME AT13664p OS=Drosophila melanogaster OX=7227 GN=tous PE=2 SV=1
11	PDB:7mqaLQ	0.297	0.555	1.515E-26	830	0.057	0.114	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8LR	0.269	0.504	3.460E-26	773	0.055	0.118	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajuUL	0.278	0.546	4.122E-25	779	0.065	0.140	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7mq8LO	0.291	0.524	3.852E-24	848	0.053	0.105	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7rroe	0.307	0.761	4.678E-24	610	0.059	0.161	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:7mqaLO	0.287	0.533	4.371E-23	819	0.054	0.110	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7d5sB2	0.291	0.532	7.829E-23	851	0.053	0.105	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	PDB:6lqsB1	0.276	0.516	3.816E-21	806	0.048	0.099	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
19	PDB:1nr0A	0.288	0.694	4.414E-21	610	0.040	0.108	1nr0A.pdb.gz
20	PDB:3sfzA	0.184	0.243	7.907E-21	1133	0.054	0.079	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L8GXY4	0.0	1361	1621	0.447	0.459	CFA43_XENLA Cilia- and flagella-associated protein 43 OS=Xenopus laevis OX=8355 GN=cfap43 PE=2 SV=1
2	B4DHB6	0.0	1958	940	0.562	0.995	B4DHB6_HUMAN cDNA FLJ56982 OS=Homo sapiens OX=9606 PE=1 SV=1
3	E9Q7R9	0.0	2533	1682	0.734	0.727	CFA43_MOUSE Cilia- and flagella-associated protein 43 OS=Mus musculus OX=10090 GN=Cfap43 PE=1 SV=1
4	Q8NDM7	0.0	3443	1665	1.000	1.000	CFA43_HUMAN Cilia- and flagella-associated protein 43 OS=Homo sapiens OX=9606 GN=CFAP43 PE=1 SV=3
5	Q580P9	5.92e-20	99.8	1460	0.117	0.133	CFA43_TRYB2 Cilia- and flagella-associated protein 43 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=CFAP43 PE=3 SV=1
6	Q57YQ1	7.76e-20	99.4	1460	0.117	0.133	Q57YQ1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.870 PE=4 SV=1
7	Q96MT7	1.44e-17	92.0	1854	0.064	0.057	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
8	E9Q5M6	1.16e-13	79.3	1843	0.063	0.057	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
9	A8J1V4	9.62e-12	72.8	1764	0.066	0.062	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
10	Q57WH1	6.27e-09	63.5	1760	0.023	0.022	CFA44_TRYB2 Cilia- and flagella-associated protein 44 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=CFAP44 PE=3 SV=1
11	Q586S4	1.62e-05	52.4	1340	0.020	0.025	Q586S4_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.175 PE=4 SV=1
12	Q57UW5	6.29e-05	50.4	1204	0.025	0.035	Q57UW5_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.570 PE=4 SV=1
13	Q38E06	2.23e-04	48.1	538	0.028	0.086	Q38E06_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1500 PE=4 SV=1
14	F1Q8Y1	8.89e-04	46.6	963	0.014	0.025	F1Q8Y1_DANRE Cilia- and flagella-associated protein 251 isoform X1 OS=Danio rerio OX=7955 GN=wdr66 PE=4 SV=2
15	Q8TBY9	0.035	41.6	1149	0.060	0.087	CF251_HUMAN Cilia- and flagella-associated protein 251 OS=Homo sapiens OX=9606 GN=CFAP251 PE=1 SV=2
16	B8JJR1	0.72	37.0	817	0.023	0.048	B8JJR1_DANRE WD repeat domain 27 OS=Danio rerio OX=7955 GN=wdr27 PE=4 SV=2
17	Q32P44	2.3	35.4	896	0.016	0.029	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
18	Q8CG46	4.5	34.7	1101	0.035	0.053	SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus OX=10090 GN=Smc5 PE=1 SV=1
19	Q8WXA3	6.1	33.9	606	0.014	0.040	RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RUFY2 PE=1 SV=3
20	A1Z6Z9	6.7	33.9	1792	0.012	0.011	A1Z6Z9_DROME Dilute class unconventional myosin, isoform A OS=Drosophila melanogaster OX=7227 GN=didum PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.2	20.8	Anaphase-promoting complex subunit 4 WD40 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373948	0.927	Cilia- and flagella-associated protein 69
2	9606.ENSP00000288912	0.831	Cilia- and flagella-associated protein 251
3	9606.ENSP00000405708	0.819	Coiled-coil domain-containing protein 39
4	9606.ENSP00000401514	0.811	Dynein heavy chain 1, axonemal
5	9606.ENSP00000340776	0.806	Cilia- and flagella-associated protein 65
6	9606.ENSP00000262765	0.805	Glutamine-rich protein 2
7	9606.ENSP00000376417	0.780	Required for sperm flagellum axoneme organization and function (By similarity). Involved in axonemal central pair complex assembly and/or stability (By similarity).
8	9606.ENSP00000339179	0.779	Testis-specific serine/threonine-protein kinase 4
9	9606.ENSP00000483621	0.746	Calcium-binding tyrosine phosphorylation-regulated protein
10	9606.ENSP00000398211	0.738	Tetratricopeptide repeat domain containing
11	9606.ENSP00000360913	0.734	Spermatogenesis-associated protein 6
12	9606.ENSP00000377197	0.725	Hydrocephalus-inducing protein homolog
13	9606.ENSP00000409964	0.725	Cilia and flagella associated protein 97
14	9606.ENSP00000389709	0.716	Probable E3 SUMO-protein ligase RNF212
15	9606.ENSP00000348314	0.710	Sperm flagellar protein 2
16	9606.ENSP00000295201	0.709	Tektin-4
17	9606.ENSP00000351327	0.704	A-kinase anchor protein 4
18	9606.ENSP00000344403	0.698	Plays a role in spermatogenesis.
19	9606.ENSP00000256246	0.673	Testis-expressed protein 15
20	9606.ENSP00000252655	0.671	Radial spoke head protein 3 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.995	cellular component organization
GO:0120316	0.991	sperm flagellum assembly
GO:0035082	0.989	axoneme assembly
GO:0007288	0.980	sperm axoneme assembly
GO:0050794	0.399	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0097729	0.999	9+2 motile cilium
GO:0005930	0.999	axoneme
GO:0005634	0.865	nucleus
GO:0036126	0.632	sperm flagellum
GO:0015630	0.524	microtubule cytoskeleton
GO:0070013	0.425	intracellular organelle lumen
GO:0031981	0.392	nuclear lumen
GO:0005654	0.364	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]