StarFunc result for job id Q8NDV1

User Input

>input (305 residues)
MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRT
HYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVG
RMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIY
PNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGSYLSTGWFTFLLAMDACYGIHVYGMIND
TYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHP
NWTLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NDV1	1.000	1.000	1.031E-65	305	1.000	1.000	Q8NDV1.pdb.gz	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
2	AFDB:Q64686	0.827	0.827	2.018E-58	305	0.859	0.859	Q64686.pdb.gz	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
3	AFDB:Q9H4F1	0.803	0.811	1.404E-38	302	0.439	0.444	Q9H4F1.pdb.gz	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
4	AFDB:Q9BVH7	0.804	0.731	2.344E-36	336	0.348	0.315	Q9BVH7.pdb.gz	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
5	AFDB:Q969X2	0.770	0.706	9.575E-31	333	0.377	0.345	Q969X2.pdb.gz	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
6	AFDB:O43173	0.549	0.450	9.489E-14	380	0.210	0.168	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
7	AFDB:B0CN48	0.545	0.453	1.010E-13	374	0.187	0.152	B0CN48.pdb.gz	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
8	AFDB:Q6KC03	0.546	0.473	3.106E-13	358	0.154	0.131	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
9	AFDB:A1KQY6	0.548	0.384	2.151E-12	454	0.210	0.141	A1KQY6.pdb.gz	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
10	AFDB:Q6ZXA0	0.561	0.485	6.214E-12	359	0.164	0.139	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
11	PDB:6aplC	0.515	0.514	1.868E-9	306	0.161	0.160	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:2plaA	0.199	0.183	5.985E-3	343	0.072	0.064	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.
13	PDB:6f2cA	0.164	0.302	2.363E-2	124	0.043	0.105	6f2cA.pdb.gz
14	PDB:6jddA	0.177	0.267	2.363E-2	176	0.062	0.108	6jddA.pdb.gz	Convergent evolution of the Cys decarboxylases involved in aminovinyl-cysteine (AviCys) biosynthesis.
15	PDB:1fdtA	0.160	0.165	3.436E-2	285	0.111	0.119	1fdtA.pdb.gz	The structure of a complex of human 17beta-hydroxysteroid dehydrogenase with estradiol and NADP+ identifies two principal targets for the design of inhibitors.
16	PDB:1nupA	0.189	0.252	4.997E-2	213	0.043	0.061	1nupA.pdb.gz	STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
17	PDB:1qzuA	0.154	0.245	6.415E-2	160	0.030	0.056	1qzuA.pdb.gz	Unusual space-group pseudosymmetry in crystals of human phosphopantothenoylcysteine decarboxylase.
18	PDB:3psaA	0.155	0.148	6.415E-2	326	0.085	0.080	3psaA.pdb.gz	Classification of a Haemophilus influenzae ABC Transporter HI1470/71 through Its Cognate Molybdate Periplasmic Binding Protein, MolA.
19	PDB:4bloL	0.140	0.150	6.828E-2	275	0.072	0.080	4bloL.pdb.gz	Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
20	PDB:4cqmF	0.174	0.202	7.267E-2	241	0.075	0.095	4cqmF.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q64686	0.0	572	305	0.859	0.859	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
2	Q8NDV1	0.0	643	305	1.000	1.000	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
3	A0A087WWK2	5.09e-99	289	139	0.449	0.986	A0A087WWK2_HUMAN ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (Fragment) OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
4	Q9H4F1	8.27e-94	281	302	0.416	0.421	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
5	Q9BVH7	2.42e-71	225	336	0.351	0.318	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
6	Q9QYJ1	2.44e-70	223	336	0.341	0.310	SIA7E_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Mus musculus OX=10090 GN=St6galnac5 PE=1 SV=1
7	Q969X2	2.03e-69	220	333	0.348	0.318	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
8	Q9JM95	7.25e-69	219	333	0.351	0.321	SIA7F_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Mus musculus OX=10090 GN=St6galnac6 PE=1 SV=1
9	Q96JF0	3.16e-13	72.0	529	0.161	0.093	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
10	Q76K27	3.35e-13	72.0	524	0.154	0.090	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
11	Q11205	3.94e-12	68.2	350	0.187	0.163	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
12	Q11204	4.09e-12	68.2	350	0.187	0.163	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
13	Q16842	1.31e-11	66.6	350	0.184	0.160	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
14	Q11201	1.97e-11	66.2	340	0.167	0.150	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
15	O43173	1.66e-10	63.5	380	0.180	0.145	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
16	Q64689	3.36e-10	62.4	380	0.180	0.145	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
17	B0CN48	5.62e-10	62.0	374	0.180	0.147	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
18	Q9W121	1.00e-09	61.2	451	0.115	0.078	Q9W121_DROME Sialyltransferase OS=Drosophila melanogaster OX=7227 GN=SiaT PE=2 SV=1
19	Q02745	1.10e-09	60.8	343	0.154	0.137	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
20	Q9GU23	1.21e-09	61.2	474	0.115	0.074	Q9GU23_DROME Beta-galactoside alpha-2,6-sialyltransferase OS=Drosophila melanogaster OX=7227 GN=SiaT PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	8.5e-28	109.2	Glycosyltransferase family 29 (sialyltransferase)
2	PF05092 PIF	1.1e+02	13.0	Per os infectivity

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321343	0.945	Alpha-2,8-sialyltransferase 8E
2	9606.ENSP00000428540	0.928	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
3	9606.ENSP00000377257	0.923	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
4	9606.ENSP00000417498	0.906	Mucin-4
5	9606.ENSP00000414350	0.904	Mucin-20
6	9606.ENSP00000485028	0.903	Mucin-13
7	9606.ENSP00000406861	0.901	Mucin-6
8	9606.ENSP00000484824	0.901	Mucin-1
9	9606.ENSP00000302716	0.900	Mucin-17
10	9606.ENSP00000311364	0.900	Mucin-like protein 1
11	9606.ENSP00000365473	0.900	Mucin-21
12	9606.ENSP00000368771	0.900	Mucin-3A
13	9606.ENSP00000381008	0.900	Mucin-16
14	9606.ENSP00000407422	0.900	Mucin-7
15	9606.ENSP00000416753	0.900	Mucin-15
16	9606.ENSP00000436812	0.900	Mucin-5B
17	9606.ENSP00000441929	0.900	Mucin-12
18	9606.ENSP00000485659	0.900	Mucin-5AC
19	9606.ENSP00000393887	0.813	Alpha-2-HS-glycoprotein
20	9606.ENSP00000156626	0.809	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005515	0.976	protein binding
GO:0001665	0.588	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:1901135	0.993	carbohydrate derivative metabolic process
GO:0006643	0.972	membrane lipid metabolic process
GO:0009100	0.966	glycoprotein metabolic process
GO:1901576	0.936	organic substance biosynthetic process
GO:0006664	0.936	glycolipid metabolic process
GO:1901566	0.921	organonitrogen compound biosynthetic process
GO:0044249	0.885	cellular biosynthetic process
GO:0006665	0.877	sphingolipid metabolic process
GO:1901137	0.870	carbohydrate derivative biosynthetic process
GO:0006687	0.798	glycosphingolipid metabolic process
GO:0006486	0.649	protein glycosylation
GO:0006672	0.539	ceramide metabolic process
GO:0019080	0.499	viral gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.906	nucleus
GO:0005654	0.899	nucleoplasm
GO:0071944	0.760	cell periphery
GO:0005886	0.739	plasma membrane
GO:0043230	0.324	extracellular organelle
GO:0065010	0.312	extracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:11136	0.588	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = a beta-D-galactosyl-(1->3)-[N-acetyl-alpha-neuraminyl-(2->6)]-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.3	0.588	Transferred entry: 2.4.3.3.

[back to server]